Populus alba (white poplar): 118052015 Help Entry 118052015         CDS       T07314                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism palz  Populus alba (white poplar) Pathway palz04145   Phagosome palz04148   Efferocytosis palz04517   IgSF CAM signaling palz04518   Integrin signaling palz04620   Toll-like receptor signaling pathway palz05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:palz00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     118052015    04518 Integrin signaling     118052015  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118052015    04148 Efferocytosis     118052015  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118052015  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     118052015  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:palz04131]     118052015   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:palz04147]     118052015    04031 GTP-binding proteins [BR:palz04031]     118052015 Membrane trafficking [BR:palz04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     118052015  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     118052015   Macropinocytosis    Ras GTPases     118052015  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     118052015 Exosome [BR:palz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118052015   Exosomal proteins of other body fluids (saliva and urine)    118052015   Exosomal proteins of colorectal cancer cells    118052015   Exosomal proteins of bladder cancer cells    118052015 GTP-binding proteins [BR:palz04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     118052015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU B12-binding Sua5_C Motif Other DBs NCBI-GeneID:  118052015 NCBI-ProteinID:  XP_034918716 LinkDB All DBs Position 15:complement(13966625..13972524) Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVAVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLVGT KLDLREDKHYLADHPGLVPVTMAQGEELRKQIGAAYYIECSSKTQQNVKAVFDAAIKVVI KPAQKQKERKKKPRRGCLLNVFCGRRLLCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagcgcttcaaggtttatcaagtgtgttactgtcggagatggggctgtaggc aagacctgtatgcttatatgttacacaagtaacaagttccctactgattatatacctaca gtgttcgataatttcagtgcaaatgtggcagttgaaggaaccactgtaaacttaggcctc tgggacacggctgggcaagaggattacaatagattaaggcccttgagctacagaggtgca gatgtctttgtcttagctttctcactagttagtcgggctagctatgaaaatgtacttaaa aagtggattccagagcttcagcattatgcccctggagttccagtagtactggttggtacc aaattggatcttcgtgaggataagcattatttggctgatcaccctggattggtgcctgtg accatggcacagggagaggaactccgaaaacagattggtgcagcatattacatcgagtgt agttcaaaaactcagcagaatgtcaaagcagtttttgatgctgcaataaaagtagttatc aaaccagcacagaaacaaaaagagaggaagaaaaagccgcgaagagggtgcctgttaaat gtcttttgcgggaggaggcttctgtgtctcaaatga

DBGET integrated database retrieval system