Populus alba (white poplar): 118055613 Help Entry 118055613         CDS       T07314                                  Name (RefSeq) sm-like protein LSM8   KO K12627   U6 snRNA-associated Sm-like protein LSm8 Organism palz  Populus alba (white poplar) Pathway palz03018   RNA degradation palz03040   Spliceosome Brite KEGG Orthology (KO) [BR:palz00001]  09120 Genetic Information Processing   09121 Transcription    03040 Spliceosome     118055613   09123 Folding, sorting and degradation    03018 RNA degradation     118055613  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:palz03019]     118055613    03041 Spliceosome [BR:palz03041]     118055613 Messenger RNA biogenesis [BR:palz03019]  Eukaryotic type   mRNA surveillance and transport factors    mRNA cycle factors     P-body specific factors      118055613   mRNA degradation factors    5'-3' decay     Lsm complex      118055613 Spliceosome [BR:palz03041]  Complex B   U4/U6.U5 tri-snRNP components    LSm proteins     118055613 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LSM RVT_2 Motif Other DBs NCBI-GeneID:  118055613 NCBI-ProteinID:  XP_034923460 LinkDB All DBs Position 1:complement(32246509..32248871) Genome browser AA seq 98 aa AA seqDB search MSIGTGLESLVDQTISIITNDGRNIVGVLKGFDQATNIILDESHERVYSTKEGVQQLVLG LYIIRGDNIGVVGELDEELDAHLDLSSLRAHPLKPVIH NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtctattggaacgggactcgagtctctcgtagatcaaacaatttcaattatcacaaat gatggccggaatatagtgggagtcttaaaaggctttgaccaggccacaaatattatcctt gatgaatctcacgagcgtgtttactccaccaaggaaggtgttcaacaactagtgttgggc ttgtacataataaggggtgacaacataggcgttgttggggaacttgatgaagagcttgat gcgcaccttgacttgtctagtctgagagctcatccactcaagcctgtcattcattga

DBGET integrated database retrieval system