Populus alba (white poplar): 118057360
Help
Entry
118057360 CDS
T07314
Name
(RefSeq) large ribosomal subunit protein uL18c
KO
K02881
large subunit ribosomal protein L18
Organism
palz
Populus alba (white poplar)
Pathway
palz03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
palz00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
118057360
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
palz03011
]
118057360
Ribosome [BR:
palz03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
118057360
Bacteria
118057360
Archaea
118057360
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
LigB
Motif
Other DBs
NCBI-GeneID:
118057360
NCBI-ProteinID:
XP_034925808
LinkDB
All DBs
Position
10:464195..467304
Genome browser
AA seq
165 aa
AA seq
DB search
MGSSGTCSLWSGFLGSGGQQLRASVAAAKQRTSPSLSFLTVEAKAKTRREDRTARHIRIR
KKVEGTPDRPRLCVFRSNKHLYVQVIDDTKMHTLASASTMQKTFAQDFDYSSGPTIEVAK
KVGEVIAKSCLEKGITKVAFDRGGYPYHGRVAALADAARENGLQF
NT seq
498 nt
NT seq
+upstream
nt +downstream
nt
atggggagcagcggtacttgttctctttggagtgggttcttaggaagtggggggcagcag
ctccgggcatcggtggcagcagccaagcagaggacaagcccaagcctaagctttttaaca
gttgaagccaaagccaaaactagacgcgaagacaggactgctcgccatattcgtatcaga
aagaaggtggaagggactccagataggcctagattgtgtgtcttccgttccaacaagcat
ctctacgtccaagtgattgatgatacaaagatgcacacgctcgcttccgcttcaaccatg
cagaagaccttcgctcaggactttgattactcttctggtccaaccattgaagtagctaag
aaggtaggtgaagtcattgcaaaatcttgtttagagaaggggataactaaggtggctttt
gacagaggtgggtacccttatcatgggcgtgtagcagcccttgcagatgcagctcgggaa
aatggccttcaattctag
DBGET
integrated database retrieval system