Populus alba (white poplar): 118058610 Help Entry 118058610         CDS       T07314                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism palz  Populus alba (white poplar) Pathway palz04145   Phagocytosis palz04517   IgSF CAM signaling palz04814   Motor proteins Brite KEGG Orthology (KO) [BR:palz00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     118058610  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     118058610   09142 Cell motility    04814 Motor proteins     118058610  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:palz03037]     118058610    04812 Cytoskeleton proteins [BR:palz04812]     118058610 Cilium and associated proteins [BR:palz03037]  Motile cilia and associated proteins   Dynein arm    118058610 Cytoskeleton proteins [BR:palz04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118058610 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  118058610 NCBI-ProteinID:  XP_034927222 LinkDB All DBs Position 1:complement(46445847..46446658) Genome browser AA seq 115 aa AA seqDB search MLEGKAIIGEADMLQTMQQDALDLAAKALDFFDVTDSTDIARLIKKEFDRMYGPGWQCIV GRDFGSFVTHCFGCFIYFQIGSLSILLFRGSAGYPEQEENQFESLGILRDLWKTI NT seq 348 nt NT seq  +upstreamnt  +downstreamnt atgctagaaggcaaggctattattggtgaggccgatatgcttcaaacaatgcaacaagat gcacttgatcttgcagccaaagccctcgacttctttgatgtcactgactccactgacata gctcgtcttattaagaaggaatttgataggatgtatggaccagggtggcaatgcattgtg ggaagagattttggctcatttgtgactcactgctttggatgtttcatatattttcagatt ggaagcctttcaattttgctcttcaggggctctgctggttatccagaacaagaggaaaac cagtttgaaagccttggaatccttagagacctttggaaaacaatctaa

DBGET integrated database retrieval system