Populus alba (white poplar): 118058818 Help Entry 118058818         CDS       T07314                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism palz  Populus alba (white poplar) Pathway palz04145   Phagosome palz04148   Efferocytosis palz04620   Toll-like receptor signaling pathway palz05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:palz00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     118058818    04148 Efferocytosis     118058818  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     118058818  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     118058818  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:palz04131]     118058818   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:palz04147]     118058818    04031 GTP-binding proteins [BR:palz04031]     118058818 Membrane trafficking [BR:palz04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     118058818  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     118058818   Macropinocytosis    Ras GTPases     118058818  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     118058818 Exosome [BR:palz04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118058818   Exosomal proteins of other body fluids (saliva and urine)    118058818   Exosomal proteins of colorectal cancer cells    118058818   Exosomal proteins of bladder cancer cells    118058818 GTP-binding proteins [BR:palz04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     118058818 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  118058818 NCBI-ProteinID:  XP_034927461 LinkDB All DBs Position 9:10802059..10806188 Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKAVLQP LKQKKKKKRQAQKACSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagcgcttcaagattcataaagtgtgtcactgttggtgatggtgctgttggcaagact tgcatgcttatttcctacactagcaacactttccctacggattacgtgccaactgtgttt gacaatttcagtgcgaatgtggttgtcgatgggagcactgtcaatttagggttgtgggat actgctggccaagaagattacaatagactgaggcctttgagctataggggggcagatgtt ttcctgcttgccttctccctcattagcaaggccagctatgaaaacgttgcaaagaaatgg attcctgaattgaggcattatgcacctggtgttccaattattcttgttgggacaaagctt gatctccgagatgataagcaattctttatagatcacccaggtgcggtgcccattaccaca gctcagggagaggaactgagaaagctaataggggctcctgtatacattgagtgcagttca aaaacacagcagaatgtcaaagccgtctttgatgcagccattaaggccgtcctccagcct ctgaagcagaagaagaaaaagaagagacaggcacaaaaggcctgctccatattgtga

DBGET integrated database retrieval system