Populus alba (white poplar): 118063405 Help Entry 118063405         CDS       T07314                                  Name (RefSeq) uncharacterized protein   KO K10756   replication factor C subunit 3/5 Organism palz  Populus alba (white poplar) Pathway palz03030   DNA replication palz03410   Base excision repair palz03420   Nucleotide excision repair palz03430   Mismatch repair Brite KEGG Orthology (KO) [BR:palz00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     118063405    03410 Base excision repair     118063405    03420 Nucleotide excision repair     118063405    03430 Mismatch repair     118063405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:palz03032]     118063405    03036 Chromosome and associated proteins [BR:palz03036]     118063405    03400 DNA repair and recombination proteins [BR:palz03400]     118063405 DNA replication proteins [BR:palz03032]  Eukaryotic type   DNA Replication Elongation Factors    RFC (replication factor C)     118063405   DNA Replication Termination Factors    ELG1-RFC complex     118063405 Chromosome and associated proteins [BR:palz03036]  Eukaryotic type   Sister chromatid cohesion proteins    CTF18-RFC complex     118063405 DNA repair and recombination proteins [BR:palz03400]  Eukaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     RFC (replication factor C)      118063405   Check point factors    HRAD17(Rad24)-RFC complex     118063405 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L14 Motif Other DBs NCBI-GeneID:  118063405 NCBI-ProteinID:  XP_073260316 LinkDB All DBs Position 14:17466367..17467890 Genome browser AA seq 132 aa AA seqDB search MVEEQSPKQLYIIHGKLQNLIEHDVSPDFFFESLLGELKKHLDEPFQLHLDGLHKDYNRN DGNMLEISENELIFLRSRHEEAGKRLHDPARKNADHLFVRIEEFNAKFMSFYKISATNNK SIQHDGFAPQLF NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atggttgaagagcaaagcccaaaacagctgtatatcatccatgggaagcttcaaaatctg atagagcatgatgtatctcctgatttctttttcgagtcccttcttggagaactgaagaag catttggatgagccatttcagctccatctcgacggtctacataaggattacaacagaaat gatggaaacatgttagagatcagtgagaacgaactgatatttctgcgcagtcgacatgag gaggctggtaaaaggcttcatgatccggcaaggaaaaatgctgatcaccttttcgtgagg attgaagagttcaatgcaaaatttatgagcttctacaagatatcagccaccaataacaaa agcattcagcatgatgggtttgctccccagttattttaa

DBGET integrated database retrieval system