Pantoea ananatis LMG 20103: PANA_0551 Help Entry PANA_0551         CDS       T01195                                  Name (GenBank) Hypothetical Protein   KO K02078   acyl carrier protein Organism pam  Pantoea ananatis LMG 20103 Pathway pam00998   Biosynthesis of various antibiotics pam01100   Metabolic pathways pam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pam00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PANA_0551    00074 Mycolic acid biosynthesis     PANA_0551   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PANA_0551 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ADD75718 UniProt:  D4GIX3 LinkDB All DBs Position 636750..637010 Genome browser AA seq 86 aa AA seqDB search MMQALYLEIKNLIITTLNLDELSADDIDSDAPLFGDGLGLDSIDALELGLAVKNAYGVVL SSESEEMRQHFFSVATLAAFIHAQRA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgatgcaagcgctttaccttgaaatcaaaaatctcattataacgacgctgaatctcgac gaactgtcggccgacgatattgatagcgatgcgccgctgtttggcgacggcttaggactg gactccatcgacgcgcttgagctgggtctggcggtaaaaaatgcctacggtgtggttctc tcgtcggaaagcgaagagatgcgccagcactttttctccgttgccacgctggcagcgttc atccacgcgcaacgtgcctga

DBGET integrated database retrieval system