KEGG Orthology (KO) [BR:pame00001]
09100 Metabolism
09104 Nucleotide metabolism
00240 Pyrimidine metabolism
138702561 (dUTPase)
09111 Xenobiotics biodegradation and metabolism
00983 Drug metabolism - other enzymes
138702561 (dUTPase)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:pame03400]
138702561 (dUTPase)
Enzymes [BR:pame01000]
3. Hydrolases
3.6 Acting on acid anhydrides
3.6.1 In phosphorus-containing anhydrides
3.6.1.23 dUTP diphosphatase
138702561 (dUTPase)
DNA repair and recombination proteins [BR:pame03400]
Eukaryotic type
Other factors with a suspected DNA repair function
Modulation of nucleotide pools
138702561 (dUTPase)
Prokaryotic type
138702561 (dUTPase)
147 aa
MPSEIYTVLRFVKLTEKAFPPVKGSAKAAGFDLRSAYDAVVPARGKELIKTDLQIQLPAG
CYGRVAPRSGLALKHHIDVGAGVVDEDYRGNVGVVLFNHSDQPFKISRGDRVAQLICQKI
FYPDLKEVEELEETERGQNGFGSTGAN