Pseudomonas amygdali: BKM19_003760 Help Entry BKM19_003760      CDS       T05354                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pamg  Pseudomonas amygdali Pathway pamg01100   Metabolic pathways pamg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pamg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKM19_003760    00074 Mycolic acid biosynthesis     BKM19_003760   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKM19_003760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVB12826 LinkDB All DBs Position complement(634039..634299) Genome browser AA seq 86 aa AA seqDB search MSDLHQDIKLLIIDALGLEDITPEDIGNDMTLFGEGLGLDSVDALELGLAIQKRYGIKID ADAKDTRNHFASVDSLAAFVSARQPA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgagcgatctgcaccaggacattaaattgttgatcatcgatgccctgggcctcgaagac atcaccccggaagatatcggcaacgatatgacgctgttcggcgaaggactgggactggac tcggtggatgcgctcgaactgggcctggccatccagaagcgctatggcatcaagatcgat gccgatgcaaaggacacccgtaaccatttcgccagcgtcgacagccttgcggccttcgtc agcgccagacaaccggcctga

DBGET integrated database retrieval system