Pseudomonas amygdali: BKM19_020470 Help Entry BKM19_020470      CDS       T05354                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism pamg  Pseudomonas amygdali Pathway pamg01100   Metabolic pathways pamg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pamg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BKM19_020470    00074 Mycolic acid biosynthesis     BKM19_020470   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BKM19_020470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVB15686 UniProt:  A0AB35QTN2 LinkDB All DBs Position complement(4190540..4190749) Genome browser AA seq 69 aa AA seqDB search MEDTVLRLIEEAMEADEGTLSKGQSLDWDSIAVLTFMSLANERLDKNLSANRLNACKSVD DVIGLVTES NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacacagtactcaggctgatcgaagaagcgatggaagcagacgaaggcaccttg agcaaaggacaaagtctggattgggactccattgcggtcctgaccttcatgtcgcttgcg aatgaacggctggataagaacctgtcggccaaccgtcttaacgcttgcaagagtgtggat gacgtcatcggtctcgttacagagtcataa

DBGET integrated database retrieval system