Paracoccus aminophilus: JCM7686_1317 Help Entry JCM7686_1317      CDS       T02792                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pami  Paracoccus aminophilus Pathway pami01100   Metabolic pathways pami01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pami00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JCM7686_1317    00074 Mycolic acid biosynthesis     JCM7686_1317   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JCM7686_1317 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AGT08418 UniProt:  S5YAG3 LinkDB All DBs Position 1294232..1294465 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVNFIQGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaaaaagatcgtcgtcgagcatctgggcgtcgacgag gacaaggtgacggaatcggcttccttcatcgatgatctgggtgcggattcgctcgacacc gtcgagctggtcatggccttcgaagaagaattcgggatcgaaattccggatgacgctgcc gagaccatccagacctttggtgacgccgtgaacttcattcagggcgcggtctga

DBGET integrated database retrieval system