Paracoccus aminophilus: JCM7686_1494 Help Entry JCM7686_1494      CDS       T02792                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pami  Paracoccus aminophilus Pathway pami01100   Metabolic pathways pami01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pami00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     JCM7686_1494    00074 Mycolic acid biosynthesis     JCM7686_1494   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     JCM7686_1494 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AGT08595 UniProt:  S5XYT4 LinkDB All DBs Position 1492842..1493105 Genome browser AA seq 87 aa AA seqDB search MTAEIRDRIVAIIAEQAMLDPAEINLETSPQDAGIDSLGLVESIFAIEEAFDISIPFNAN EPEKSEFDISTLGSIIAAVEKLVAEKV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacggcagaaatccgtgaccgcattgttgccatcattgccgagcaggcgatgctggac cccgccgagatcaatctcgaaacctcgccgcaggatgcgggcatcgacagcctcgggctg gtcgaatcgattttcgcaatcgaagaggccttcgacatctcgatcccgttcaatgccaat gagcccgagaaatccgaattcgacatctcgacgctcggctcgatcatcgccgccgtcgag aaactggtggccgagaaagtatga

DBGET integrated database retrieval system