Paracoccus aminophilus: JCM7686_2989 Help Entry JCM7686_2989      CDS       T02792                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism pami  Paracoccus aminophilus Brite KEGG Orthology (KO) [BR:pami00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:pami03110]     JCM7686_2989 Chaperones and folding catalysts [BR:pami03110]  Protein folding catalysts   Protein disulfide isomerase    JCM7686_2989 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 GST_N_3 Glrx-like SH3BGR CLIC-like_N Motif Other DBs NCBI-ProteinID:  AGT10025 UniProt:  S5Y2R1 LinkDB All DBs Position 3088512..3088769 Genome browser AA seq 85 aa AA seqDB search MAKIEIYLTDTCPFCHRAKALLTAKGVPFTEINVTGDPDARAAMTERANGRHTVPQIFIN SESIGGNDRLQALEMRGQLNALIGL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggccaagatcgagatctatctcaccgacacctgccctttctgccaccgcgccaaggcg ctgttgaccgccaagggcgtgcctttcaccgaaatcaacgtgaccggcgacccggatgcg cgcgccgcgatgaccgaacgggcaaatggccgccataccgtgccccagatcttcatcaac agcgaatcgattggcggcaatgaccgtctgcaggcgctggagatgcgggggcaactgaac gcgctgatcggtctctga

DBGET integrated database retrieval system