KEGG   Paracoccus aminovorans: JCM7685_1821
Entry
JCM7685_1821      CDS       T05468                                 
Name
(GenBank) peptide/nickel transport system, permease protein
  KO
K02034  peptide/nickel transport system permease protein
Organism
pamn  Paracoccus aminovorans
Pathway
pamn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pamn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    JCM7685_1821
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pamn02000]
    JCM7685_1821
Transporters [BR:pamn02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    JCM7685_1821
SSDB
Motif
Pfam: BPD_transp_1 OppC_N
Other DBs
NCBI-ProteinID: CQR86386
LinkDB
Position
I:complement(1827220..1828125)
AA seq 301 aa
MTETTRAWLLSDAPQTRRQARLGALYHGWLTFRANRLAMLGLAILVLLVLTAAFAPWLAP
QDPYAQNLAERLKPPSAAHWLGTDALGRDILSRLIFGSRVTLFIVGTVALIAPVIGLFVG
TVAGFAGGWLDQVLMRITDIFLAFPKLILALAFVAALGPGIGNAVLALAITSWPPYARLA
RAETLTIRNADYIAAARLQGAGPLRLLIGHVWPLCVSSLIVRVALDMAGIILSAAGLGFL
GLGAQPPMPEWGAMISDGRTYILDFWWVAAMPGMAIFIVSLAFNLLGDGLRDVLDPKGGR
E
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaccgagacgacgcgcgcatggctgctttccgacgcgccgcagacccggcggcaggcg
cggctgggcgcgctctatcacggctggctgaccttccgggccaacaggctggccatgctg
gggctggcgatcctggtcctgctggtgctgacggccgccttcgcgccctggctcgcgccg
caggatccctatgcccagaacctggccgagcggctgaagccgccctcggccgcgcactgg
ttgggcaccgacgcgctggggcgggacatcctgtcgcggctgatcttcgggtcgcgggtg
acgctgttcatcgtcggcaccgtggcgctgatcgcgccggtgatcgggctcttcgtcggc
acggtggcgggctttgccggcggctggctggaccaggtgctgatgcggatcaccgacatc
ttcctggccttcccgaagctgatcctggcgctggccttcgtcgccgcgctgggccccggc
atcggcaatgcggtgctggcgctggcgatcacctcctggccgccctatgcccggctggcg
cgggccgagaccctgaccatccgcaacgccgattacatcgccgccgcccggctgcagggc
gcggggccgctgcggctgctgatcggccatgtctggccgctctgcgtcagttcgctgatc
gtgcgggtggcgctggacatggcggggatcatcctctcggccgcaggcctcggcttcctc
gggctcggcgcgcagccgccgatgccggaatggggggcgatgatctcggacgggcgcacc
tatatcctggatttctggtgggtcgcggccatgcccggcatggcgatcttcatcgtctcg
ctggccttcaacctgctcggcgacgggttgcgcgacgtgctggatcccaagggaggccgg
gaatga

DBGET integrated database retrieval system