Profundibacter amoris: BAR1_04495 Help Entry BAR1_04495        CDS       T06831                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pamo  Profundibacter amoris Pathway pamo01100   Metabolic pathways pamo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pamo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAR1_04495    00074 Mycolic acid biosynthesis     BAR1_04495   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAR1_04495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXX97258 UniProt:  A0A347UEI0 LinkDB All DBs Position complement(899840..900085) Genome browser AA seq 81 aa AA seqDB search MTQTDIETLLKDELHRIAPDIEINEIDRDEDLREEFDIDSLDFLNLVTALGKALNTPMPE ADYPQMGTYNEMIAYLTQKTA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacccagaccgacattgaaaccctgttaaaggacgagttgcatcgcatcgcccctgat atcgagatcaatgaaattgaccgcgacgaggatttgcgagaagaattcgacatcgactcg ctggacttcctgaacctcgtcaccgctcttggcaaagcgctgaacacacctatgcccgaa gccgattacccacagatgggaacctacaatgaaatgatagcataccttacccaaaaaacg gcctaa

DBGET integrated database retrieval system