Profundibacter amoris: BAR1_06345 Help Entry BAR1_06345        CDS       T06831                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pamo  Profundibacter amoris Pathway pamo01100   Metabolic pathways pamo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pamo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BAR1_06345    00074 Mycolic acid biosynthesis     BAR1_06345   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BAR1_06345 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  AXX97588 UniProt:  A0A347UFG0 LinkDB All DBs Position 1268131..1268364 Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVAEKASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVSFITKAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcagatcgcgttaaaaagattgttgtcgagcacctgggtgtggaagaa gacaaagtagcagaaaaagcatcgttcatcgatgatctgggcgctgacagcctggacacg gttgaactggttatggcttttgaagaagagttcggcattgaaattccggatgacgctgct gaaacgattcagacattcggcgacgctgtgtcgttcatcacaaaagcttcttaa

DBGET integrated database retrieval system