KEGG   Pantoea sp. MT58: IAI47_01595
Entry
IAI47_01595       CDS       T10894                                 
Symbol
ugpA
Name
(GenBank) sn-glycerol-3-phosphate ABC transporter permease UgpA
  KO
K05814  sn-glycerol 3-phosphate transport system permease protein
Organism
pamt  Pantoea sp. MT58
Pathway
pamt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pamt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    IAI47_01595 (ugpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pamt02000]
    IAI47_01595 (ugpA)
Transporters [BR:pamt02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Putative sn-Glycerol 3-phosphate transporter
    IAI47_01595 (ugpA)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: QNQ58988
LinkDB
Position
346823..347710
AA seq 295 aa
MSSSRPVFRTSLLPYLLVLPQLLITAIFFLWPAGEALWYSLQSLDPFGISSSFVGLENFR
RLFADPYYLDSFWTTIKFSGMVTVFGMVFSLLLAALVDYVVRLRRLYQTLLLLPYAVAPV
VAAVLWMFLFNPGLGLFSYLLNHVGYNWNFAQNSGQAMFLVVLASIWQQMSYNFLFFFAA
LQSIPKSLVEAAAIDGAGPVRRFFNLSLPLITPVSFFLLVVNLIYAFFDTFPVIDAATGG
GPVQATTTLIYKIYREGFTGLDLSSSAAQSVVLMLLVIGLTVLQFRFVERKVQYQ
NT seq 888 nt   +upstreamnt  +downstreamnt
atgtcttcatcccgtccggtctttcgcaccagtctgttgccctatcttctggtactgccg
caactgctgattaccgccatcttctttctctggcctgcgggtgaagcgctgtggtactcg
ctgcaaagcctcgatccctttggcatctccagcagctttgtcgggctggaaaacttcaga
cggctatttgccgatccttactatctggattccttctggaccacgataaaattcagtggc
atggtcacggtgtttggcatggtcttctcgctgctgctggcggcgctggtggattatgtg
gtacgactccgccgcctctatcagaccctgctgctactgccttacgccgttgcgccggtg
gtggctgcggtgctgtggatgtttctgtttaaccctggcctgggtctgttcagctacctg
ctgaaccacgtcggctacaactggaacttcgcgcagaacagcggtcaggcgatgttcctg
gtggtgctggcctcgatctggcagcagatgagctacaacttcctgtttttctttgccgca
ctgcagtctatccctaaatcgctggtggaagccgctgccatcgacggtgccggaccggtg
cgtcgcttcttcaacctctcactgccgctgatcacgccggtcagcttcttcctgctggtg
gtgaacctgatctacgccttcttcgataccttcccggtgatcgatgccgcaaccggcggc
gggccggtgcaggcgaccaccacgctgatctacaaaatctatcgcgaaggctttaccggt
ctggatctctcctcttccgcggcgcagtcggtggtgctgatgttgctggtgatcgggctg
acggtgcttcagttccgctttgttgaacgtaaggtgcaataccaatga

DBGET integrated database retrieval system