Pandoraea sp. XY-2: DRB87_04945 Help Entry DRB87_04945       CDS       T06086                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism pand  Pandoraea sp. XY-2 Pathway pand02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pand00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     DRB87_04945  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pand02035]     DRB87_04945 Bacterial motility proteins [BR:pand02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     DRB87_04945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  QBC30838 LinkDB All DBs Position 1066307..1066585 Genome browser AA seq 92 aa AA seqDB search MSEAGATPVAPSATLEAAAEQFEAIFVAQLLGEMRRATEALRDDRDDAGALGKRDRTTHG LHEWADTQVAQALAARRAFGIADIIIRQMAGR NT seq 279 nt NT seq  +upstreamnt  +downstreamnt ttgtctgaggcaggcgcaacgccggttgcgccgagtgcgacgctcgaagccgccgccgaa cagttcgaagcgatcttcgtcgcccagttgctcggcgaaatgcgacgggcgaccgaggcg ctgcgcgacgatcgcgatgacgccggcgcgctgggcaaacgcgaccgcacgacgcacggc ctgcacgaatgggcggacacacaggtcgcacaggcgcttgcggcgcgccgtgcattcggc atcgccgacatcatcatccggcaaatggcggggcgctga

DBGET integrated database retrieval system