Pandoraea sp. XY-2: DRB87_09100 Help Entry DRB87_09100       CDS       T06086                                  Name (GenBank) RNA-binding protein Hfq   KO K03666   host factor-I protein Organism pand  Pandoraea sp. XY-2 Pathway pand02024   Quorum sensing pand03018   RNA degradation Brite KEGG Orthology (KO) [BR:pand00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DRB87_09100  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DRB87_09100  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pand03019]     DRB87_09100    03036 Chromosome and associated proteins [BR:pand03036]     DRB87_09100 Messenger RNA biogenesis [BR:pand03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DRB87_09100 Chromosome and associated proteins [BR:pand03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DRB87_09100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QBC31486 LinkDB All DBs Position 1984692..1984928 Genome browser AA seq 78 aa AA seqDB search MSNKGQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESFDQYVVLLRNTVTQMVYKHAI STVVPARPVNFHPEAEQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaacaaagggcaacttctacaagacccgtttctgaacgccttgcgtaaggagcat gttcccgtctcgatctatctggtcaacggtatcaagctgcagggaaacatcgagtcgttt gaccagtatgtcgtcctgctgcgcaacacggtcacccaaatggtttataagcatgccatt tcgacggtcgtgcctgcgcgtccggtgaatttccatccggaagccgagcagtcctga

DBGET integrated database retrieval system