Pandoraea sp. XY-2: DRB87_12555 Help Entry DRB87_12555       CDS       T06086                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pand  Pandoraea sp. XY-2 Pathway pand00998   Biosynthesis of various antibiotics pand01100   Metabolic pathways pand01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pand00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DRB87_12555    00074 Mycolic acid biosynthesis     DRB87_12555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DRB87_12555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QBC33900 LinkDB All DBs Position 2762190..2762465 Genome browser AA seq 91 aa AA seqDB search MASLELEIKQLIVQSLELEDIAVDDIADDIPLFGDGLGLDSIDALELGIALRKRFGLQIE AGDDAARAQFRSVATLAQLLRDRGCAQKETE NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atggcttcactagaacttgaaatcaagcaattgatcgtccagtcccttgaactggaagac attgcggtggacgacatcgccgacgacattcccttgttcggcgatggcctcggcctggac tccatcgatgcgctcgagttgggcatcgccctgcgcaagcgcttcggcctgcaaatcgaa gcgggcgacgacgccgcgcgcgcccagttccgcagtgttgccaccctcgcccagttgctg cgcgaccgcggctgcgcccagaaggaaaccgaatga

DBGET integrated database retrieval system