Pandoraea sp. XY-2: DRB87_15445 Help Entry DRB87_15445       CDS       T06086                                  Name (GenBank) hypothetical protein   KO K01779   aspartate racemase [EC:5.1.1.13] Organism pand  Pandoraea sp. XY-2 Pathway pand00250   Alanine, aspartate and glutamate metabolism pand00470   D-Amino acid metabolism pand01054   Nonribosomal peptide structures pand01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:pand00001]  09100 Metabolism   09105 Amino acid metabolism    00250 Alanine, aspartate and glutamate metabolism     DRB87_15445   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     DRB87_15445   09109 Metabolism of terpenoids and polyketides    01054 Nonribosomal peptide structures     DRB87_15445  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pand01008]     DRB87_15445 Enzymes [BR:pand01000]  5. Isomerases   5.1  Racemases and epimerases    5.1.1  Acting on amino acids and derivatives     5.1.1.13  aspartate racemase      DRB87_15445 Polyketide biosynthesis proteins [BR:pand01008]  Nonribosomal peptide tailoring proteins   Others    DRB87_15445 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asp_Glu_race Motif Other DBs NCBI-ProteinID:  QBC32469 LinkDB All DBs Position 3419941..3420333 Genome browser AA seq 130 aa AA seqDB search MMVITMNSHATLGILGGMGPAAGIDLCRKIVDQHPAHRDQDHIPFILYSVPQIPTAPRRY CATVLHRWTACSTAFTRWSSLALAALPLPATRPMPGLTHCVIAPGCRCSMWSKPSRASWP NASRRARSSA NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgatggtcatcaccatgaactcgcacgccacgctcggcatcctcggcggcatgggcccc gccgccggcatcgacctctgccgcaagatcgtcgatcaacatccggcccaccgcgatcag gatcacatcccgttcattctctactcggttccccagatcccgaccgcaccgaggcgctat tgcgcgacggtgcttcaccgctggacggcatgctcgacggcgttcacgcgctggagcagt ctggcgttggctgcattgccattgcctgcaacacggcccatgcctggcttgacgcactgc gtcatcgcacccggctgccggtgctcgatgtggtcgaagccgtcgcgggcgagctggccc aatgcgtcgcgccgggcgcgctcatcggcctga

DBGET integrated database retrieval system