Pandoraea sp. XY-2: DRB87_18735 Help Entry DRB87_18735       CDS       T06086                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pand  Pandoraea sp. XY-2 Pathway pand00998   Biosynthesis of various antibiotics pand01100   Metabolic pathways pand01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pand00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DRB87_18735    00074 Mycolic acid biosynthesis     DRB87_18735   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DRB87_18735 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Ribosomal_L50 TerB DUF1493 HLH Motif Other DBs NCBI-ProteinID:  QBC32964 LinkDB All DBs Position complement(4143638..4143877) Genome browser AA seq 79 aa AA seqDB search MDNIEQRVKKIVAEQLGVNEADVKNESSFVNDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQQAIDYVQGNSKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggataacattgagcaacgcgtcaagaagatcgtcgccgaacaacttggtgtgaacgaa gctgacgtcaagaacgaatccagctttgtgaacgatctcggcgccgactcgctcgacacg gttgagctggtgatggcactggaagaagagttcgagacggaaatcccggacgagcaagcc gaaaagatcaccacggtgcagcaagccatcgattacgttcaaggcaattccaaggcctaa

DBGET integrated database retrieval system