Pseudomonas anuradhapurensis: HU763_023570 Help Entry HU763_023570      CDS       T07691                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism panh  Pseudomonas anuradhapurensis Brite KEGG Orthology (KO) [BR:panh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panh03036]     HU763_023570 Chromosome and associated proteins [BR:panh03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HU763_023570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Asd-4 ZapB Motif Other DBs NCBI-ProteinID:  QXI50382 LinkDB All DBs Position 5170721..5170903 Genome browser AA seq 60 aa AA seqDB search MSRFELLIQRVEQLKRQNALLVAQEKSWREERAHLIEKNEIARRKVESMILRLKALEQDS NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagccgattcgagttgctgatccaacgcgtcgagcaactaaaacggcaaaatgcactc ctagtagctcaggaaaaatcctggcgcgaagagcgcgcccacctcatcgaaaagaacgag atcgccaggcgcaaggtcgagtcgatgattttacgcctcaaggctctggagcaagactca tga

DBGET integrated database retrieval system