Polynucleobacter antarcticus: DCO16_06755 Help Entry DCO16_06755       CDS       T08332                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pani  Polynucleobacter antarcticus Pathway pani02024   Quorum sensing pani03018   RNA degradation Brite KEGG Orthology (KO) [BR:pani00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     DCO16_06755  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     DCO16_06755  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pani03019]     DCO16_06755    03036 Chromosome and associated proteins [BR:pani03036]     DCO16_06755 Messenger RNA biogenesis [BR:pani03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      DCO16_06755 Chromosome and associated proteins [BR:pani03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     DCO16_06755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM SRP14 Gag_p24_C Motif Other DBs NCBI-ProteinID:  QKM62779 UniProt:  A0A6M9PQ97 LinkDB All DBs Position complement(1293502..1293744) Genome browser AA seq 80 aa AA seqDB search MNISKTQLLQDPFLNALRKEHVPVSIYLVNGIKLQGNIESYDQYVILLRNTVTQMVYKHA ISTIVPARAVEFRTEEPSPA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacattagtaaaacccagttactacaagaccccttcctcaatgctttgcgcaaagag catgtgccagtgtctatttatctagttaatggcatcaagttgcagggcaatattgaatcc tatgatcagtatgtgattttgttgcgcaataccgtcacccagatggtttacaaacacgcg atttccactattgttcccgctcgcgctgtggaattccgtacggaagagccaagccctgca taa

DBGET integrated database retrieval system