KEGG   Pandoraea sp. NE5: PanNE5_26350
Entry
PanNE5_26350      CDS       T10412                                 
Name
(GenBank) short-chain dehydrogenase/reductase
Organism
pann  Pandoraea sp. NE5
Pathway
pann04382  Cornified envelope formation
Brite
KEGG Orthology (KO) [BR:pann00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04382 Cornified envelope formation
    PanNE5_26350
SSDB
Motif
Pfam: adh_short adh_short_C2 Epimerase DUF1776 KR NmrA DNA_pol_lambd_f GDP_Man_Dehyd RmlD_sub_bind
Other DBs
NCBI-ProteinID: BDD93195
LinkDB
Position
2923694..2924500
AA seq 268 aa
MPNSEVVVVTGVSSGIGRATAEKFAKRGCRVFGTVRSIAKAVPLAGVELVEMDVRDDASV
RTGIHAIVDRAGRIDVLVNNAGTTLIGAVEETSVAEAAALLDTNVFSILRTTQAVLPYMR
AQRRGRIVNISSVLGFLPAPYMGLYAASKHAVEGLTETLDHEVRQFGIRATLIEPSFTRT
NLDVNAPQASSNIAAYDRERALASGAVVDSVKGAPAPDGVANTIVEAALGSWRMRRTPAG
QASLLRKLRRFMPSGPVDASLRKTFGLA
NT seq 807 nt   +upstreamnt  +downstreamnt
atgcctaattccgaagtggtcgttgtcaccggcgtgtcgtctggtatcggacgcgcgacc
gccgagaagttcgcgaagcgcgggtgccgcgtatttggcaccgtgcgcagcatcgcgaaa
gcggtgccattggccggcgttgagctggtggagatggatgtgcgcgacgatgcttccgtt
cgaaccgggattcatgcgatcgtcgatcgtgccgggcgtatcgacgtactcgtcaacaat
gccggcacgacgctgatcggcgcggttgaggaaacgtcggttgccgaagctgcggcgctg
ctcgataccaacgtattcagcattctgcgtacgacccaggcggtgcttccctatatgcgg
gcgcaacgacgcggacggattgtcaatatcagttcggtacttggctttttgccggcacct
tacatgggactctatgcggcgtccaagcatgccgtcgaggggttgaccgagacactggat
cacgaggtgcgccagttcggcatccgcgcaacgctgatcgagccgtcctttacccgaacc
aatctcgatgtcaacgcgcctcaagcgagttcgaatatcgccgcctatgaccgcgagcgt
gcgcttgcatcgggcgccgtcgtcgacagcgtcaaaggtgctcccgcacccgatggcgtg
gcaaacacaatcgttgaagccgcgctcggcagctggcgtatgcgtcgtacgcccgcgggt
caggcgtcgctcctgagaaaattgcggcgcttcatgccctccgggccggtcgatgccagc
ttgaggaaaactttcgggctcgcgtga

DBGET integrated database retrieval system