Pandoraea sp. NE5: PanNE5_34800 Help Entry PanNE5_34800      CDS       T10412                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pann  Pandoraea sp. NE5 Pathway pann00998   Biosynthesis of various antibiotics pann01100   Metabolic pathways pann01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pann00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PanNE5_34800    00074 Mycolic acid biosynthesis     PanNE5_34800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PanNE5_34800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  BDD94040 LinkDB All DBs Position complement(3868744..3869007) Genome browser AA seq 87 aa AA seqDB search MASLELEIKQLIVQSLELEDIAVDDIADDIPLFGDGLGLDSIDALELGIALRKRFGLQIE AGDDAARAQFRSVATLAQLLRERGCTQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggcttcactagaacttgaaatcaagcaattgatcgtccagtcccttgaactggaagac attgcggtggacgacatcgccgacgacattcccttgttcggcgatggcctcggcctggac tccatcgatgcgctcgagttgggcatcgccctgcgcaagcgcttcggcctgcaaatcgaa gcgggcgacgacgccgcgcgcgcccagttccgcagtgttgccaccctcgcccagttgctg cgcgagcgcggctgcacccagtaa

DBGET integrated database retrieval system