Pantoea anthophila: OJ965_13890 Help Entry OJ965_13890       CDS       T08866                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pano  Pantoea anthophila Pathway pano01100   Metabolic pathways pano01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pano00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OJ965_13890 (acpP)    00074 Mycolic acid biosynthesis     OJ965_13890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OJ965_13890 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 HLH Ribosomal_L50 DUF1493 DUF8312 Motif Other DBs NCBI-ProteinID:  UZH01800 LinkDB All DBs Position complement(2457297..2457533) Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIISEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcatcagtgagcagctgggtgtgaaagag gaagaagtcaccaactctgcatctttcgtagaagacctgggtgccgattctcttgatacc gttgagctggtgatggctctggaagaagagtttgatactgagattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgactacatcaatagccataaaggctaa

DBGET integrated database retrieval system