Pantoea sp. PSNIH2: PSNIH2_10265 Help Entry PSNIH2_10265      CDS       T03514                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism panp  Pantoea sp. PSNIH2 Pathway panp01100   Metabolic pathways panp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:panp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSNIH2_10265    00074 Mycolic acid biosynthesis     PSNIH2_10265   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSNIH2_10265 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Ribosomal_L50 DUF6952 Motif Other DBs NCBI-ProteinID:  AIX74125 LinkDB All DBs Position complement(2220701..2220937) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIISEQLGVKQEEVTNEKSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINNHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatctccgagcagcttggcgttaagcag gaagaagtcaccaacgaaaaatctttcgttgaagatcttggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcactactgttcaggctgctattgattacatcaataaccatcaggcctaa

DBGET integrated database retrieval system