Pseudomonas antarctica: A7J50_3581 Help Entry A7J50_3581        CDS       T04830                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism panr  Pseudomonas antarctica Brite KEGG Orthology (KO) [BR:panr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:panr03032]     A7J50_3581    03036 Chromosome and associated proteins [BR:panr03036]     A7J50_3581    03400 DNA repair and recombination proteins [BR:panr03400]     A7J50_3581 DNA replication proteins [BR:panr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     A7J50_3581 Chromosome and associated proteins [BR:panr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     A7J50_3581 DNA repair and recombination proteins [BR:panr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       A7J50_3581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_1 Barstar Motif Other DBs NCBI-ProteinID:  ANF86957 UniProt:  A0A172Z395 LinkDB All DBs Position complement(3992311..3992583) Genome browser AA seq 90 aa AA seqDB search MNKSELIDAIAASADIPKAAAGRALDAVIESVTGALKAGDSVVLVGFGTFSVTDRPARTG RNPQTGKALQIAAAKKPGFKAGKALKEAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtcggaactgattgatgctatcgccgcatccgctgatatcccgaaagctgct gctggccgtgcgctggacgcagtaatcgaatccgtcactggcgctctgaaggccggcgac tccgtggtactggtaggcttcggtactttctctgtgactgatcgcccagctcgcactggc cgtaacccacagactggcaaagcactgcaaatcgctgccgccaagaaaccaggtttcaaa gccggtaaagccctgaaagaagctgttaactaa

DBGET integrated database retrieval system