Pantoea sp. SO10: FCN45_07315 Help Entry FCN45_07315       CDS       T06053                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pans  Pantoea sp. SO10 Pathway pans01100   Metabolic pathways pans01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pans00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FCN45_07315    00074 Mycolic acid biosynthesis     FCN45_07315   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FCN45_07315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QCP59189 LinkDB All DBs Position 1582583..1582840 Genome browser AA seq 85 aa AA seqDB search MQVLINDIKQMIIDTLNLEDISPDDIETDAPLFGEGLGLDSIDALELGLAVKNRFGVQLS AESETLRAHFFSVATLAAFVEQQQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaagtactgattaacgacatcaaacagatgattatcgacacgctgaatctggaagat atcagccctgacgacatcgaaaccgacgcaccgctgtttggcgaggggctgggcctcgat tcaatcgatgcgctggagctgggactggcggtgaaaaatcgcttcggcgtacagctctcc gccgagagtgaaacgctgcgcgcgcactttttttccgtggctacactggccgcgtttgtt gaacaacagcaagcctga

DBGET integrated database retrieval system