Pantoea sp. SO10: FCN45_07520 Help Entry FCN45_07520       CDS       T06053                                  Symbol flgM Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pans  Pantoea sp. SO10 Pathway pans02020   Two-component system pans02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pans00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     FCN45_07520 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     FCN45_07520 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pans02035]     FCN45_07520 (flgM) Bacterial motility proteins [BR:pans02035]  Flagellar system   Flagellar assembly proteins    Others     FCN45_07520 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM DUF6285 Motif Other DBs NCBI-ProteinID:  QCP59226 LinkDB All DBs Position complement(1622539..1622844) Genome browser AA seq 101 aa AA seqDB search MSIDRTQPTNPVSTVQTRDNNDNSSKVRQSATPAASTTSESGAEVKLSTAQAQLMQPGSK DINTARVEQLKTAIRNGELKMDTGKIADALIADTKAYLEGN NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgagcatcgacagaacgcagcctacgaatccggttagcactgttcaaacacgcgacaat aacgataacagcagcaaagtgcgtcagagcgcgacgccagcagccagcaccaccagcgaa agcggtgcggaagtgaagttgagtaccgcgcaggcgcaactgatgcagcctggcagcaaa gatattaatacagcgcgcgttgagcagctgaagacggccattcgtaatggcgaattgaaa atggataccggtaagatcgccgacgcgctgatcgccgataccaaggcgtatttagagggt aactaa

DBGET integrated database retrieval system