KEGG   Pantoea sp. PSNIH1: PSNIH1_01670
Entry
PSNIH1_01670      CDS       T03464                                 
Name
(GenBank) homocysteine methyltransferase
  KO
K00547  homocysteine S-methyltransferase [EC:2.1.1.10]
Organism
pant  Pantoea sp. PSNIH1
Pathway
pant00270  Cysteine and methionine metabolism
pant00670  One carbon pool by folate
pant01100  Metabolic pathways
pant01110  Biosynthesis of secondary metabolites
pant04981  Folate transport and metabolism
Brite
KEGG Orthology (KO) [BR:pant00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PSNIH1_01670
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    PSNIH1_01670
 09150 Organismal Systems
  09154 Digestive system
   04981 Folate transport and metabolism
    PSNIH1_01670
Enzymes [BR:pant01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.10  homocysteine S-methyltransferase
     PSNIH1_01670
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-ProteinID: AIX49055
LinkDB
Position
complement(314255..315187)
AA seq 310 aa
MPRNPIAEALTQTRPLILDGALATELEARGCDLADSLWSAKVLMEQPELIYAVHRDYFAA
GAQVAITASYQATPRGFAARGLESGKAGELIRLSVTLAQRARDDYRAASGTTAPLLVAGS
VGPWGAYLANGAEYRGDYALPPEEMKDFHRPRVAALLEAGVDLLACETLPSFGEAQALIA
LLAEFPQSSAWFSFTLRDAEHISDGTPLESVMKVINAAPQVVAVGINCIALESVTPALRT
LQALTQKPLLVYPNSGEQYDAESKSWHSAPSGCTLQEKFSEWQQAGAQLIGGCCRTSPED
IRAIAACCQR
NT seq 933 nt   +upstreamnt  +downstreamnt
atgccgcgtaacccgattgctgaagcactcacccagacccgtccgctgatccttgatggc
gcactggccaccgagctggaggcgcgcggctgcgatctggcagattccctctggtcagca
aaggtgctgatggagcagccggaactgatttatgccgtgcaccgcgactactttgctgcc
ggcgcgcaggtagcgatcaccgccagctatcaggcaacgccgcgcggttttgccgcgcgc
ggtctggaaagcggcaaggcgggcgagctgattcgcctgagcgtgacgctggcgcagcgt
gcacgcgatgattatcgcgccgcttccggcaccacggcgccgctgctggttgccggttca
gtggggccgtggggcgcctatctggcaaacggggccgaatatcgcggcgattacgcgctg
ccgccggaagagatgaaagatttccaccggccgcgcgtggcggcgctgctggaagcgggt
gtcgacctgctggcgtgtgaaacgctgccgtcgtttggtgaagcgcaggcgctgatcgcg
ctgctggctgaatttccgcaaagcagcgcgtggttttcgtttacgctgcgtgatgcagag
catatcagcgacggcacgccgcttgagagcgtgatgaaggtgattaacgcggcaccgcag
gtggtggcggtggggatcaactgtatcgcgctggagagcgtcacgccggcgctgcggacg
ctgcaggcgctgacgcagaagccgctgctggtctaccctaactcgggcgagcagtatgat
gcagagagtaaaagctggcactcggcaccctctggctgcacgctgcaggagaagttcagc
gaatggcagcaggcgggtgcgcagctgattggcggctgctgccggacgtcgcctgaggat
atccgggcaattgctgcctgttgtcaacgctga

DBGET integrated database retrieval system