Pantoea sp. PSNIH1: PSNIH1_11915 Help Entry PSNIH1_11915      CDS       T03464                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pant  Pantoea sp. PSNIH1 Pathway pant01100   Metabolic pathways pant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PSNIH1_11915    00074 Mycolic acid biosynthesis     PSNIH1_11915   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PSNIH1_11915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  AIX50890 LinkDB All DBs Position 2495609..2495845 Genome browser AA seq 78 aa AA seqDB search MSDIEQRVKKIVAEQLGVKEDEVVNTASFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTSHQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaacaacgcgttaagaaaatcgtagctgagcagctgggcgttaaagaa gacgaagtggttaacactgcttctttcgttgaagacctgggtgcagattctcttgacacc gttgagctggtaatggctctggaagaagagtttgatactgaaattccagacgaagaagct gagaaaatcactaccgttcaggcagcgatcgattacgtcactagccatcaaggctaa

DBGET integrated database retrieval system