Pantoea sp. PSNIH1: PSNIH1_12130
Help
Entry
PSNIH1_12130 CDS
T03464
Name
(GenBank) peptidase S66
KO
K01297
muramoyltetrapeptide carboxypeptidase [EC:
3.4.17.13
]
Organism
pant
Pantoea sp. PSNIH1
Brite
KEGG Orthology (KO) [BR:
pant00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01002 Peptidases and inhibitors [BR:
pant01002
]
PSNIH1_12130
01011 Peptidoglycan biosynthesis and degradation proteins [BR:
pant01011
]
PSNIH1_12130
Enzymes [BR:
pant01000
]
3. Hydrolases
3.4 Acting on peptide bonds (peptidases)
3.4.17 Metallocarboxypeptidases
3.4.17.13 muramoyltetrapeptide carboxypeptidase
PSNIH1_12130
Peptidases and inhibitors [BR:
pant01002
]
Serine peptidases
Family S66
PSNIH1_12130
Peptidoglycan biosynthesis and degradation proteins [BR:
pant01011
]
Precursor biosynthesis
Carboxypeptidase
PSNIH1_12130
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Peptidase_S66C
Peptidase_S66
DUF1375
Motif
Other DBs
NCBI-ProteinID:
AIX50932
LinkDB
All DBs
Position
complement(2536775..2537698)
Genome browser
AA seq
307 aa
AA seq
DB search
MHPARSFRLIAPSGYCHNQDAARRGIERLQHAGHRVENGAVVARRFQRFAGTDAERLADI
NALAASDPLPDIILAVRGGYGATRLLDKLDYRSIAQRLSSEPVALCGHSDFTAIQLALLA
QTGLISFSGPMLAGNFGADPVSAFTEHHFWQAISSPELRVNWQSESPDCGSWQGRLWGGN
LAMICALIGTPWLPQIEGGILVIEDVNEHPFRIERMLLQLQQCGILARQQAIITGSFTST
SLSAYDNGFGFDTVWQRLRDEYQLPVISDLAFGHAPDTVTLPLGAHATLDMSAGNARLSI
TGHPVLR
NT seq
924 nt
NT seq
+upstream
nt +downstream
nt
atgcacccagcccgttcctttcgtttaatcgccccttctggctattgccacaaccaggat
gctgcccggcgcggcattgagcggcttcagcatgcaggccaccgggtggagaatggcgca
gtggttgcccgccgctttcagcgctttgccggtacggacgcagaacgtctggcggatatc
aatgcgctggctgcatcagacccgctgccggacattattctggcagtgcgcggtggctac
ggtgcgacccgcctgctggacaagctggattaccgcagtatcgcgcagcgtctcagcagt
gagccagtcgcgctgtgcggccacagtgactttaccgctattcagctggcgctgctggcg
cagaccggcctgataagcttcagcggcccgatgctggccggtaatttcggcgcggatccc
gtttcagcgtttaccgaacaccatttctggcaggccatttcctctccggaactgagagta
aactggcagagtgaaagcccggactgcggcagctggcagggccgcctgtggggcggtaac
ctggcgatgatctgcgcgctgattggtacgccgtggctgccgcagattgaaggcggcatt
ctggtgattgaagatgtcaatgaacatccgtttcgcatcgagcgcatgctgctgcagctg
cagcagtgcggcattctggcgcgtcagcaggcgattattaccggtagttttaccagtacc
tccctcagcgcctatgataacggcttcggtttcgacactgtctggcagcgcctgcgcgat
gagtatcagctgccggtgataagcgatctggcgtttggacatgcgcctgataccgtcacg
ctgccgctgggtgcgcatgctacgcttgatatgagtgccggcaacgcgcggctcagcatc
accggacatccggtgctgcgataa
DBGET
integrated database retrieval system