Papio anubis (olive baboon): 100137220 Help Entry 100137220         CDS       T07474                                  Symbol IL5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04630   JAK-STAT signaling pathway panu04640   Hematopoietic cell lineage panu04657   IL-17 signaling pathway panu04658   Th1 and Th2 cell differentiation panu04660   T cell receptor signaling pathway panu04664   Fc epsilon RI signaling pathway panu04672   Intestinal immune network for IgA production panu05200   Pathways in cancer panu05310   Asthma panu05320   Autoimmune thyroid disease panu05321   Inflammatory bowel disease panu05330   Allograft rejection Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100137220 (IL5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100137220 (IL5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     100137220 (IL5)    04660 T cell receptor signaling pathway     100137220 (IL5)    04658 Th1 and Th2 cell differentiation     100137220 (IL5)    04657 IL-17 signaling pathway     100137220 (IL5)    04664 Fc epsilon RI signaling pathway     100137220 (IL5)    04672 Intestinal immune network for IgA production     100137220 (IL5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100137220 (IL5)   09163 Immune disease    05310 Asthma     100137220 (IL5)    05320 Autoimmune thyroid disease     100137220 (IL5)    05321 Inflammatory bowel disease     100137220 (IL5)    05330 Allograft rejection     100137220 (IL5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     100137220 (IL5)    00536 Glycosaminoglycan binding proteins [BR:panu00536]     100137220 (IL5) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Interleukins    100137220 (IL5) Glycosaminoglycan binding proteins [BR:panu00536]  Heparan sulfate / Heparin   Cytokines    100137220 (IL5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 DUF6034 Motif Other DBs NCBI-GeneID:  100137220 NCBI-ProteinID:  NP_001162229 Ensembl:  ENSPANG00000018674 UniProt:  A9CB10 LinkDB All DBs Position 5:complement(125299676..125314837) Genome browser AA seq 118 aa AA seqDB search MYAVPTEIPTSALVKETLALLSTHRTLLIGNETLRIPVPVHKHHQLCTEEIFQGIGTLES QTAQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtatgccgtccccacagaaattcccacaagtgcattggtgaaagagaccttggcactg ctttctactcatcgaactctgctgataggcaatgagactctgaggattcctgttcctgta cataaacatcaccaactgtgcactgaagaaatctttcagggaataggcacactggagagt caaactgcgcaagggggtactgtggaaagactattcaaaaacttgtctttaataaagaaa tacattgacggccaaaaaaagaagtgtggagaagaaagacggagagtaaaccaattccta gactacctgcaagagtttcttggtgtaatgaacaccgagtggataatagaaagttga

DBGET integrated database retrieval system