Papio anubis (olive baboon): 100381197 Help Entry 100381197         CDS       T07474                                  Symbol CCL2 Name (RefSeq) C-C motif chemokine 2 precursor   KO K14624   C-C motif chemokine 2 Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04061   Viral protein interaction with cytokine and cytokine receptor panu04062   Chemokine signaling pathway panu04621   NOD-like receptor signaling pathway panu04657   IL-17 signaling pathway panu04668   TNF signaling pathway panu04933   AGE-RAGE signaling pathway in diabetic complications panu05135   Yersinia infection panu05142   Chagas disease panu05144   Malaria panu05163   Human cytomegalovirus infection panu05164   Influenza A panu05168   Herpes simplex virus 1 infection panu05171   Coronavirus disease - COVID-19 panu05323   Rheumatoid arthritis panu05417   Lipid and atherosclerosis panu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     100381197 (CCL2)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100381197 (CCL2)    04061 Viral protein interaction with cytokine and cytokine receptor     100381197 (CCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100381197 (CCL2)    04657 IL-17 signaling pathway     100381197 (CCL2)    04062 Chemokine signaling pathway     100381197 (CCL2)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100381197 (CCL2)    05164 Influenza A     100381197 (CCL2)    05168 Herpes simplex virus 1 infection     100381197 (CCL2)    05163 Human cytomegalovirus infection     100381197 (CCL2)   09171 Infectious disease: bacterial    05135 Yersinia infection     100381197 (CCL2)   09174 Infectious disease: parasitic    05144 Malaria     100381197 (CCL2)    05142 Chagas disease     100381197 (CCL2)   09163 Immune disease    05323 Rheumatoid arthritis     100381197 (CCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100381197 (CCL2)    05418 Fluid shear stress and atherosclerosis     100381197 (CCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100381197 (CCL2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     100381197 (CCL2)    00536 Glycosaminoglycan binding proteins [BR:panu00536]     100381197 (CCL2) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Chemokines    100381197 (CCL2) Glycosaminoglycan binding proteins [BR:panu00536]  Heparan sulfate / Heparin   Chemokines    100381197 (CCL2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 GPR15L CXCL16 Motif Other DBs NCBI-GeneID:  100381197 NCBI-ProteinID:  NP_001167009 Ensembl:  ENSPANG00000035858 UniProt:  C9EI28 LinkDB All DBs Position 17:26963975..26965427 Genome browser AA seq 99 aa AA seqDB search MKVSAALLCLLLIAATFSPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQIQTPKP NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgaaagtctctgcagcacttctgtgcctgctgctcatagcagccaccttcagcccccag gggctcgctcagccagatgcaatcaatgcccccgtcacttgctgctataacttcaccaat aggaagatctcagtgcagaggctggcgagctatagaagaatcaccagcagcaagtgtccc aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag aagtgggttcaggattccatggaccatctggacaagcaaatccaaactccgaagccttga

DBGET integrated database retrieval system