Papio anubis (olive baboon): 100997835 Help Entry 100997835         CDS       T07474                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism panu  Papio anubis (olive baboon) Pathway panu04014   Ras signaling pathway panu04015   Rap1 signaling pathway panu04020   Calcium signaling pathway panu04022   cGMP-PKG signaling pathway panu04024   cAMP signaling pathway panu04070   Phosphatidylinositol signaling system panu04114   Oocyte meiosis panu04218   Cellular senescence panu04261   Adrenergic signaling in cardiomyocytes panu04270   Vascular smooth muscle contraction panu04371   Apelin signaling pathway panu04625   C-type lectin receptor signaling pathway panu04713   Circadian entrainment panu04720   Long-term potentiation panu04722   Neurotrophin signaling pathway panu04728   Dopaminergic synapse panu04740   Olfactory transduction panu04744   Phototransduction panu04750   Inflammatory mediator regulation of TRP channels panu04910   Insulin signaling pathway panu04912   GnRH signaling pathway panu04915   Estrogen signaling pathway panu04916   Melanogenesis panu04921   Oxytocin signaling pathway panu04922   Glucagon signaling pathway panu04924   Renin secretion panu04925   Aldosterone synthesis and secretion panu04970   Salivary secretion panu04971   Gastric acid secretion panu05010   Alzheimer disease panu05012   Parkinson disease panu05022   Pathways of neurodegeneration - multiple diseases panu05031   Amphetamine addiction panu05034   Alcoholism panu05133   Pertussis panu05152   Tuberculosis panu05163   Human cytomegalovirus infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05170   Human immunodeficiency virus 1 infection panu05200   Pathways in cancer panu05214   Glioma panu05417   Lipid and atherosclerosis panu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100997835 (CALML5)    04015 Rap1 signaling pathway     100997835 (CALML5)    04070 Phosphatidylinositol signaling system     100997835 (CALML5)    04024 cAMP signaling pathway     100997835 (CALML5)    04022 cGMP-PKG signaling pathway     100997835 (CALML5)  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     100997835 (CALML5)    04915 Estrogen signaling pathway     100997835 (CALML5)    04921 Oxytocin signaling pathway     100997835 (CALML5)    04924 Renin secretion     100997835 (CALML5)    04925 Aldosterone synthesis and secretion     100997835 (CALML5)   09154 Digestive system    04970 Salivary secretion     100997835 (CALML5)    04971 Gastric acid secretion     100997835 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     100997835 (CALML5)    04720 Long-term potentiation     100997835 (CALML5)    04722 Neurotrophin signaling pathway     100997835 (CALML5)   09157 Sensory system    04740 Olfactory transduction     100997835 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     100997835 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     100997835 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100997835 (CALML5)   09162 Cancer: specific types    05214 Glioma     100997835 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100997835 (CALML5)    05163 Human cytomegalovirus infection     100997835 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     100997835 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     100997835 (CALML5)    05152 Tuberculosis     100997835 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     100997835 (CALML5)    05012 Parkinson disease     100997835 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     100997835 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     100997835 (CALML5)    05034 Alcoholism     100997835 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100997835 (CALML5)    05418 Fluid shear stress and atherosclerosis     100997835 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:panu01009]     100997835 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     100997835 (CALML5)    03036 Chromosome and associated proteins [BR:panu03036]     100997835 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     100997835 (CALML5) Protein phosphatases and associated proteins [BR:panu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100997835 (CALML5) Membrane trafficking [BR:panu04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100997835 (CALML5) Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100997835 (CALML5) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100997835 (CALML5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 EH AIF-1 EF_EFCAB10_C SPARC_Ca_bdg Dockerin_1 DUF5580_M EF-hand_11 TerB DUF7370 DUF6471 UPF0154 SurA_N_2 Motif Other DBs NCBI-GeneID:  100997835 NCBI-ProteinID:  XP_021798702 LinkDB All DBs Position 11:120665926..120667954 Genome browser AA seq 146 aa AA seqDB search MAGELTPEEEAEYKSAFSAVDTNGSGTINAQELGAALKAMGKNLSEAQLQNLISQVDSDG DGEISFEEFMAAVKKTRAGREDLQVAFRAFDQDGDGHITVDELKQAMAGLGQPLPQEELD AMIREADVDQDGRVNYEEFARMLTQK NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggccggtgagctgactcctgaggaggaggccgagtacaaaagcgccttctccgcggtt gacacgaatggaagcggcaccatcaatgcccaggagctgggcgcggcgctgaaggccatg ggcaagaatttgtcggaggcccagctacagaatctcatctcccaggttgatagcgacggc gacggcgaaatcagcttcgaggagttcatggcggcggtgaagaagaccagggccggccgg gaggacctgcaggtcgccttccgcgccttcgaccaggacggcgatggccacatcaccgtg gacgagctcaagcaggccatggcggggctggggcagccgctgccgcaggaggagctggat gccatgatccgcgaggccgacgtggaccaggacgggcgggtgaactacgaggagttcgcg aggatgctcacccagaagtga

DBGET integrated database retrieval system