Papio anubis (olive baboon): 100998967 Help Entry 100998967         CDS       T07474                                  Symbol PFN3 Name (RefSeq) profilin-3   KO K05759   profilin Organism panu  Papio anubis (olive baboon) Pathway panu04015   Rap1 signaling pathway panu04810   Regulation of actin cytoskeleton panu05014   Amyotrophic lateral sclerosis panu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100998967 (PFN3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100998967 (PFN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100998967 (PFN3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100998967 (PFN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:panu04131]     100998967 (PFN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     100998967 (PFN3)    04147 Exosome [BR:panu04147]     100998967 (PFN3) Membrane trafficking [BR:panu04131]  Others   Actin-binding proteins    Others     100998967 (PFN3) Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      100998967 (PFN3) Exosome [BR:panu04147]  Exosomal proteins   Proteins found in most exosomes    100998967 (PFN3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  100998967 NCBI-ProteinID:  XP_003900639 UniProt:  A0A8I5NC12 LinkDB All DBs Position 5:complement(170093413..170093960) Genome browser AA seq 137 aa AA seqDB search MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRCTFL QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDPRAVCVGHAPRALLVLMGRRGVHGGI LNKTVHELIRGLRMQGA NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgggcgactggaaggtctacatcagtgcagtgttgcgggaccagcgcatcgacgacgtg gccatcgtgggccatgcggataacagctgcgtgtgggcttcgcggcccgggggcctgctg gctgccatctcgccgcaggaggtgggtgtgctcacggggcccgaccgttgcaccttcctt caggcgggcctgagcgtgggcggccgccgctgctgcgtcatccgcgaccacctgctggcc gagggcgacggcgtgctggacgcacgcaccaagggactggacccgcgcgccgtgtgcgtg ggccacgcgccgcgcgcgctcctggtgctcatgggccgacgcggcgtccatgggggcatc ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

DBGET integrated database retrieval system