Papio anubis (olive baboon): 101001497 Help Entry 101001497         CDS       T07474                                  Symbol CSTB Name (RefSeq) cystatin-B   KO K13907   cystatin-A/B Organism panu  Papio anubis (olive baboon) Brite KEGG Orthology (KO) [BR:panu00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:panu01002]     101001497 (CSTB)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101001497 (CSTB) Peptidases and inhibitors [BR:panu01002]  Peptidase inhibitors   Family I25: cystatin family    101001497 (CSTB) Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    101001497 (CSTB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cystatin Dynein_light SQAPI Motif Other DBs NCBI-GeneID:  101001497 NCBI-ProteinID:  XP_003895466 Ensembl:  ENSPANG00000007154 UniProt:  A0A096NIL5 LinkDB All DBs Position 4:complement(179142828..179149146) Genome browser AA seq 98 aa AA seqDB search MMCGAPSAVQPATAETQDIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVG DEDFVHLRVFKSLPHENKPLTLSDYQTNKAKHDELSYF NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtgcggggcgccctccgccgtgcagccggccaccgccgagacccaggacatcgcc gaccaggtgaggtcccagcttgaagagaaagaaaacaagaagttccctgtatttaaggcc gtgtcgttcaagagccaggttgtcgcggggacaaactacttcatcaaggtgcacgttggc gacgaggacttcgtacacctgcgagtgttcaaatctctccctcacgaaaacaagcccttg accttgtctgactaccagaccaacaaagccaagcacgacgagctgagctatttctga

DBGET integrated database retrieval system