Papio anubis (olive baboon): 101002912 Help Entry 101002912         CDS       T07474                                  Name (RefSeq) myosin light polypeptide 6-like   KO K12751   myosin light chain 6 Organism panu  Papio anubis (olive baboon) Pathway panu04270   Vascular smooth muscle contraction panu04530   Tight junction panu04814   Motor proteins panu04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:panu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101002912   09142 Cell motility    04814 Motor proteins     101002912  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     101002912   09153 Circulatory system    04270 Vascular smooth muscle contraction     101002912  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     101002912    04147 Exosome [BR:panu04147]     101002912 Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101002912 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101002912   Exosomal proteins of bladder cancer cells    101002912 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_6 EF-hand_7 EF-hand_1 FlgE_D2 Motif Other DBs NCBI-GeneID:  101002912 NCBI-ProteinID:  XP_031513600 LinkDB All DBs Position 17:63455138..63455767 Genome browser AA seq 152 aa AA seqDB search MMCDFTEDQTAEFKEAFQLFDRIGDGKILCNKYGDVMRALGQNPTNTEVLKVLGNPKSNE MNVKVLEFEYLLPILQTVAKNKDQGTYEDYVEGLQVFDKEGNGTVMGVEFWLVLVTLGEK ITEEEVEVLVAGNEGSNGCINYEAIVRHILSG NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgatgtgtgacttcaccgaggatcagactgcagagttcaaggaggccttccagctgttt gaccgaataggtgatggcaagatcctgtgcaacaaatatggggatgtgatgagggcactg ggtcagaaccccaccaacactgaggtgctcaaggttctggggaaccccaagagtaatgag atgaacgtgaaggtgctagaatttgagtaccttctgcccatactgcagacagtggccaag aacaaggaccagggcacctatgaagattatgtagaaggacttcaggtgtttgacaaggaa ggaaatggcaccgtcatgggtgttgaattctggcttgttcttgtcacactgggtgagaag ataacagaggaagaggtagaggtgctcgtggcagggaatgagggcagcaatggttgtatc aactatgaagcaattgtgaggcacatcctgtcggggtga

DBGET integrated database retrieval system