Papio anubis (olive baboon): 101003583 Help Entry 101003583         CDS       T07474                                  Symbol CCL19 Name (RefSeq) C-C motif chemokine 19   KO K05512   C-C motif chemokine 19 Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04061   Viral protein interaction with cytokine and cytokine receptor panu04062   Chemokine signaling pathway panu04064   NF-kappa B signaling pathway Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     101003583 (CCL19)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101003583 (CCL19)    04061 Viral protein interaction with cytokine and cytokine receptor     101003583 (CCL19)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     101003583 (CCL19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     101003583 (CCL19) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Chemokines    101003583 (CCL19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101003583 NCBI-ProteinID:  XP_003911609 Ensembl:  ENSPANG00000025338 UniProt:  A0A2I3MYR9 LinkDB All DBs Position 13:complement(62733646..62735426) Genome browser AA seq 98 aa AA seqDB search MALLLALSLLVLWTSPAPTLSGTNDAEDCCLSVTQKPIPGYIVRNFRYLLIKDGCRVPAV VFTTLRGRQLCAPPDQSWVERIIQRLQRTSTKMKRRSS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggccctgctactggccctcagcctgctggttctctggacctccccagccccaactctg agtggcaccaatgatgctgaagactgctgcctgtctgtgacccagaaacccatcccgggg tatatcgtgaggaatttccgctaccttctcatcaaggatggctgcagggtgcctgctgtg gtgttcaccacactgaggggccgccagctctgtgcacccccagaccagtcctgggtagaa cgcatcatccagagactgcagaggacctcaaccaagatgaagcgccgcagcagttaa

DBGET integrated database retrieval system