Papio anubis (olive baboon): 101004981 Help Entry 101004981         CDS       T07474                                  Symbol PPP3R2 Name (RefSeq) calcineurin subunit B type 2   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism panu  Papio anubis (olive baboon) Pathway panu04010   MAPK signaling pathway panu04020   Calcium signaling pathway panu04022   cGMP-PKG signaling pathway panu04114   Oocyte meiosis panu04218   Cellular senescence panu04310   Wnt signaling pathway panu04360   Axon guidance panu04370   VEGF signaling pathway panu04380   Osteoclast differentiation panu04625   C-type lectin receptor signaling pathway panu04650   Natural killer cell mediated cytotoxicity panu04658   Th1 and Th2 cell differentiation panu04659   Th17 cell differentiation panu04660   T cell receptor signaling pathway panu04662   B cell receptor signaling pathway panu04720   Long-term potentiation panu04724   Glutamatergic synapse panu04921   Oxytocin signaling pathway panu04922   Glucagon signaling pathway panu04924   Renin secretion panu05010   Alzheimer disease panu05014   Amyotrophic lateral sclerosis panu05020   Prion disease panu05022   Pathways of neurodegeneration - multiple diseases panu05031   Amphetamine addiction panu05152   Tuberculosis panu05163   Human cytomegalovirus infection panu05166   Human T-cell leukemia virus 1 infection panu05167   Kaposi sarcoma-associated herpesvirus infection panu05170   Human immunodeficiency virus 1 infection panu05235   PD-L1 expression and PD-1 checkpoint pathway in cancer panu05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101004981 (PPP3R2)    04310 Wnt signaling pathway     101004981 (PPP3R2)    04370 VEGF signaling pathway     101004981 (PPP3R2)    04020 Calcium signaling pathway     101004981 (PPP3R2)    04022 cGMP-PKG signaling pathway     101004981 (PPP3R2)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     101004981 (PPP3R2)    04218 Cellular senescence     101004981 (PPP3R2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101004981 (PPP3R2)    04650 Natural killer cell mediated cytotoxicity     101004981 (PPP3R2)    04660 T cell receptor signaling pathway     101004981 (PPP3R2)    04658 Th1 and Th2 cell differentiation     101004981 (PPP3R2)    04659 Th17 cell differentiation     101004981 (PPP3R2)    04662 B cell receptor signaling pathway     101004981 (PPP3R2)   09152 Endocrine system    04922 Glucagon signaling pathway     101004981 (PPP3R2)    04921 Oxytocin signaling pathway     101004981 (PPP3R2)    04924 Renin secretion     101004981 (PPP3R2)   09156 Nervous system    04724 Glutamatergic synapse     101004981 (PPP3R2)    04720 Long-term potentiation     101004981 (PPP3R2)   09158 Development and regeneration    04360 Axon guidance     101004981 (PPP3R2)    04380 Osteoclast differentiation     101004981 (PPP3R2)  09160 Human Diseases   09161 Cancer: overview    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     101004981 (PPP3R2)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     101004981 (PPP3R2)    05170 Human immunodeficiency virus 1 infection     101004981 (PPP3R2)    05163 Human cytomegalovirus infection     101004981 (PPP3R2)    05167 Kaposi sarcoma-associated herpesvirus infection     101004981 (PPP3R2)   09171 Infectious disease: bacterial    05152 Tuberculosis     101004981 (PPP3R2)   09164 Neurodegenerative disease    05010 Alzheimer disease     101004981 (PPP3R2)    05014 Amyotrophic lateral sclerosis     101004981 (PPP3R2)    05020 Prion disease     101004981 (PPP3R2)    05022 Pathways of neurodegeneration - multiple diseases     101004981 (PPP3R2)   09165 Substance dependence    05031 Amphetamine addiction     101004981 (PPP3R2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     101004981 (PPP3R2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:panu01009]     101004981 (PPP3R2) Protein phosphatases and associated proteins [BR:panu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      101004981 (PPP3R2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EH EF-hand_9 YtfJ_HI0045 Motif Other DBs NCBI-GeneID:  101004981 NCBI-ProteinID:  XP_003911477 LinkDB All DBs Position 13:complement(70835962..70841635) Genome browser AA seq 173 aa AA seqDB search MSTMGNEASYPAEMCAHFDNDEIKRLGRRFRKLDLDKSGSLSVEEFMSLPELRHNPLVRR VIDVFDTNDDGEVDFKEFILGTSQFSVKGDEEQKLRFAFSIYDMDKDGYISNGELFQVLK MMVGNNLPDWQLQQLVDKTILILDKDGDGKISFEEFSAVVRDLEIHKKLVLIV NT seq 522 nt NT seq  +upstreamnt  +downstreamnt atgtccacaatgggaaacgaggccagttacccggcggagatgtgcgcccactttgacaat gatgaaattaaaaggctgggcaggaggtttcggaagttggacttggacaaatcaggctct ctgagcgtggaggagttcatgtccctgccggagctgcgccacaacccgttggtgcggcga gtgatcgacgtcttcgacaccaacgacgatggagaagtggacttcaaggaattcatcctg gggacctctcagttcagcgtcaagggcgacgaggagcagaagttgaggtttgcgtttagc atttacgacatggataaagatggctacatttccaacggggagctcttccaggtgctgaag atgatggtgggcaacaacctgccggactggcagctccagcagctggtcgacaaaaccatc ctcatcctggacaaggatggcgatgggaagatatcctttgaggaattcagtgctgtggtc agagacctggagatccacaagaagctggtcctcatcgtgtga

DBGET integrated database retrieval system