Papio anubis (olive baboon): 101005107 Help Entry 101005107         CDS       T07474                                  Symbol CCL27 Name (RefSeq) C-C motif chemokine 27   KO K16598   C-C motif chemokine 27 Organism panu  Papio anubis (olive baboon) Pathway panu04060   Cytokine-cytokine receptor interaction panu04061   Viral protein interaction with cytokine and cytokine receptor panu04062   Chemokine signaling pathway Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     101005107 (CCL27)    04061 Viral protein interaction with cytokine and cytokine receptor     101005107 (CCL27)  09150 Organismal Systems   09151 Immune system    04062 Chemokine signaling pathway     101005107 (CCL27)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     101005107 (CCL27) Cytokines and neuropeptides [BR:panu04052]  Cytokines   Chemokines    101005107 (CCL27) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  101005107 NCBI-ProteinID:  XP_021783125 Ensembl:  ENSPANG00000025340 UniProt:  A0A096P1A5 LinkDB All DBs Position 13:complement(62705278..62706866) Genome browser AA seq 112 aa AA seqDB search MKGPSTFCSLLLLSLLLSPDPTAAFLLPPSTACCTQLYRKPLSYKLLRKVIRVELQEADG DCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPNLNFGMLRKMG NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atgaaggggccctcaaccttctgcagtctcctgctcctgtcattgctcctgagcccagac cctacagcagcattcctactgccacccagcactgcctgctgtactcagctctaccgaaaa ccactctcatacaagctactgaggaaggtcatccgggtggaactgcaggaggctgatggg gactgtcatctccaggctttcgtgcttcacctggctcaacgcagcatctgcatccacccc cagaaccccagcctgtcacagtggtttgagcaccaagagagaaagctccacgggactctg cccaacctgaattttgggatgctaaggaaaatgggctga

DBGET integrated database retrieval system