Papio anubis (olive baboon): 101005127 Help Entry 101005127         CDS       T07474                                  Name (RefSeq) glutathione S-transferase A5   KO K00799   glutathione S-transferase [EC:2.5.1.18] Organism panu  Papio anubis (olive baboon) Pathway panu00480   Glutathione metabolism panu00980   Metabolism of xenobiotics by cytochrome P450 panu00982   Drug metabolism - cytochrome P450 panu00983   Drug metabolism - other enzymes panu01100   Metabolic pathways panu01524   Platinum drug resistance panu05200   Pathways in cancer panu05204   Chemical carcinogenesis - DNA adducts panu05207   Chemical carcinogenesis - receptor activation panu05208   Chemical carcinogenesis - reactive oxygen species panu05225   Hepatocellular carcinoma panu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:panu00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     101005127   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     101005127    00982 Drug metabolism - cytochrome P450     101005127    00983 Drug metabolism - other enzymes     101005127  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     101005127    05204 Chemical carcinogenesis - DNA adducts     101005127    05207 Chemical carcinogenesis - receptor activation     101005127    05208 Chemical carcinogenesis - reactive oxygen species     101005127   09162 Cancer: specific types    05225 Hepatocellular carcinoma     101005127   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     101005127   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     101005127  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:panu02000]     101005127 Enzymes [BR:panu01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      101005127 Transporters [BR:panu02000]  Other transporters   Pores ion channels [TC:1]    101005127 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C GST_C_3 GST_N Motif Other DBs NCBI-GeneID:  101005127 NCBI-ProteinID:  XP_031522984 LinkDB All DBs Position 6:complement(51250162..51254818) Genome browser AA seq 113 aa AA seqDB search MVEIDGMKLVQTRAILNYIASKYNLYGKDIKERALIDMYTEGIVDLTEMVSLLITCQPEE RDAKTALVKEKIQNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVAA NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggttgagattgatgggatgaagctggtgcagaccagagccattctcaactacattgcc agcaaatacaacctctacgggaaagacataaaggagagagccctgattgatatgtataca gaaggaatagtagatttgactgaaatggtctctcttctgatcacatgtcaacctgaggaa agagatgccaagactgccttggtcaaagagaaaattcaaaaccgctatttccctgccttt gaaaaagtcttaaagagtcatggacaagactaccttgttggcaacaagctgagccgggct gatattcacctggtggaacttctctactacgtagcagcttga

DBGET integrated database retrieval system