Papio anubis (olive baboon): 101006047 Help Entry 101006047         CDS       T07474                                  Symbol GAST Name (RefSeq) gastrin isoform X2   KO K13768   gastrin Organism panu  Papio anubis (olive baboon) Pathway panu04081   Hormone signaling panu04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:panu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     101006047 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     101006047 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:panu04052]     101006047 (GAST) Cytokines and neuropeptides [BR:panu04052]  Neuropeptides   GPCR binding    101006047 (GAST) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  101006047 NCBI-ProteinID:  XP_003913062 Ensembl:  ENSPANG00000021514 LinkDB All DBs Position 17:48892556..48898477 Genome browser AA seq 104 aa AA seqDB search MQQLCVYVLIFTLALAAFSEASWKPRSQQPDAPLGTGANRNLELPWLDQQGPASHHRRQL GPQGPPQLVADPSKKQGPWMEEEEAAYGWMDFGRRSAEDENQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcaactgtgtgtgtatgtgctgatctttacactggctctggctgccttctctgaa gcttcttggaagccccgctcccagcagccagatgcacccttaggtacaggggccaacagg aacctggagctaccctggctggaccagcaaggcccagcctctcaccaccgaaggcagctg ggaccccagggtcccccacaacttgtggcagacccatccaagaagcagggaccatggatg gaggaagaagaagcagcctatggatggatggactttggccgccgcagtgccgaggatgag aaccaacaaccctag

DBGET integrated database retrieval system