Papio anubis (olive baboon): 101006236 Help Entry 101006236         CDS       T07474                                  Name (RefSeq) histone H2B type 2-E-like   KO K11252   histone H2B Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05203   Viral carcinogenesis panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101006236  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     101006236   09163 Immune disease    05322 Systemic lupus erythematosus     101006236   09165 Substance dependence    05034 Alcoholism     101006236  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101006236   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101006236 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101006236 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101006236 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Topoisom_I_N JHY ARM_TT21 CENP-T_C Motif Other DBs NCBI-GeneID:  101006236 NCBI-ProteinID:  XP_031522055 LinkDB All DBs Position 1:complement(120317963..120321836) Genome browser AA seq 117 aa AA seqDB search MRTASVKSGLGLAVPEPAKSAPAPKKGAKKAVTKAQKKDGKKRKRSRKESYSICMYEVLK QVHPDTGISSEAMGIMNSFANDIFERIAGEASRLAHYNKRSTITSRESHTALRLLRE NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcgcacggcctctgtaaagtcgggcttgggtctggccgtgcctgaacctgcaaagtcc gcgccggctcccaagaagggcgccaagaaagccgtcaccaaagcccagaagaaagacggc aagaagcgcaagcgcagccgcaaggagagctactccatctgcatgtacgaggtgctgaag caggtccaccccgacaccggcatctcgtccgaggccatgggcatcatgaactccttcgcc aacgacatcttcgagcgcatcgcgggagaggcgtcccgcctggcgcactacaacaagcgc tccaccatcacgtcccgcgagagccacacggccctgcgcctgctgagggaataa

DBGET integrated database retrieval system