KEGG   Papio anubis (olive baboon): 101006756
Entry
101006756         CDS       T07474                                 
Symbol
MAPK3
Name
(RefSeq) mitogen-activated protein kinase 3 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
panu  Papio anubis (olive baboon)
Pathway
panu01521  EGFR tyrosine kinase inhibitor resistance
panu01522  Endocrine resistance
panu01524  Platinum drug resistance
panu04010  MAPK signaling pathway
panu04012  ErbB signaling pathway
panu04014  Ras signaling pathway
panu04015  Rap1 signaling pathway
panu04022  cGMP-PKG signaling pathway
panu04024  cAMP signaling pathway
panu04062  Chemokine signaling pathway
panu04066  HIF-1 signaling pathway
panu04068  FoxO signaling pathway
panu04071  Sphingolipid signaling pathway
panu04072  Phospholipase D signaling pathway
panu04114  Oocyte meiosis
panu04140  Autophagy - animal
panu04148  Efferocytosis
panu04150  mTOR signaling pathway
panu04151  PI3K-Akt signaling pathway
panu04210  Apoptosis
panu04218  Cellular senescence
panu04261  Adrenergic signaling in cardiomyocytes
panu04270  Vascular smooth muscle contraction
panu04350  TGF-beta signaling pathway
panu04360  Axon guidance
panu04370  VEGF signaling pathway
panu04371  Apelin signaling pathway
panu04380  Osteoclast differentiation
panu04510  Focal adhesion
panu04517  IgSF CAM signaling
panu04520  Adherens junction
panu04540  Gap junction
panu04550  Signaling pathways regulating pluripotency of stem cells
panu04611  Platelet activation
panu04613  Neutrophil extracellular trap formation
panu04620  Toll-like receptor signaling pathway
panu04621  NOD-like receptor signaling pathway
panu04625  C-type lectin receptor signaling pathway
panu04650  Natural killer cell mediated cytotoxicity
panu04657  IL-17 signaling pathway
panu04658  Th1 and Th2 cell differentiation
panu04659  Th17 cell differentiation
panu04660  T cell receptor signaling pathway
panu04662  B cell receptor signaling pathway
panu04664  Fc epsilon RI signaling pathway
panu04666  Fc gamma R-mediated phagocytosis
panu04668  TNF signaling pathway
panu04713  Circadian entrainment
panu04720  Long-term potentiation
panu04722  Neurotrophin signaling pathway
panu04723  Retrograde endocannabinoid signaling
panu04724  Glutamatergic synapse
panu04725  Cholinergic synapse
panu04726  Serotonergic synapse
panu04730  Long-term depression
panu04810  Regulation of actin cytoskeleton
panu04910  Insulin signaling pathway
panu04912  GnRH signaling pathway
panu04914  Progesterone-mediated oocyte maturation
panu04915  Estrogen signaling pathway
panu04916  Melanogenesis
panu04917  Prolactin signaling pathway
panu04919  Thyroid hormone signaling pathway
panu04921  Oxytocin signaling pathway
panu04926  Relaxin signaling pathway
panu04928  Parathyroid hormone synthesis, secretion and action
panu04929  GnRH secretion
panu04930  Type II diabetes mellitus
panu04933  AGE-RAGE signaling pathway in diabetic complications
panu04934  Cushing syndrome
panu04935  Growth hormone synthesis, secretion and action
panu04960  Aldosterone-regulated sodium reabsorption
panu05010  Alzheimer disease
panu05020  Prion disease
panu05022  Pathways of neurodegeneration - multiple diseases
panu05034  Alcoholism
panu05132  Salmonella infection
panu05133  Pertussis
panu05135  Yersinia infection
panu05140  Leishmaniasis
panu05142  Chagas disease
panu05145  Toxoplasmosis
panu05152  Tuberculosis
panu05160  Hepatitis C
panu05161  Hepatitis B
panu05163  Human cytomegalovirus infection
panu05164  Influenza A
panu05165  Human papillomavirus infection
panu05166  Human T-cell leukemia virus 1 infection
panu05167  Kaposi sarcoma-associated herpesvirus infection
panu05170  Human immunodeficiency virus 1 infection
panu05171  Coronavirus disease - COVID-19
panu05200  Pathways in cancer
panu05203  Viral carcinogenesis
panu05205  Proteoglycans in cancer
panu05206  MicroRNAs in cancer
panu05207  Chemical carcinogenesis - receptor activation
panu05208  Chemical carcinogenesis - reactive oxygen species
panu05210  Colorectal cancer
panu05211  Renal cell carcinoma
panu05212  Pancreatic cancer
panu05213  Endometrial cancer
panu05214  Glioma
panu05215  Prostate cancer
panu05216  Thyroid cancer
panu05218  Melanoma
panu05219  Bladder cancer
panu05220  Chronic myeloid leukemia
panu05221  Acute myeloid leukemia
panu05223  Non-small cell lung cancer
panu05224  Breast cancer
panu05225  Hepatocellular carcinoma
panu05226  Gastric cancer
panu05230  Central carbon metabolism in cancer
panu05231  Choline metabolism in cancer
panu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
panu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:panu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101006756 (MAPK3)
   04012 ErbB signaling pathway
    101006756 (MAPK3)
   04014 Ras signaling pathway
    101006756 (MAPK3)
   04015 Rap1 signaling pathway
    101006756 (MAPK3)
   04350 TGF-beta signaling pathway
    101006756 (MAPK3)
   04370 VEGF signaling pathway
    101006756 (MAPK3)
   04371 Apelin signaling pathway
    101006756 (MAPK3)
   04668 TNF signaling pathway
    101006756 (MAPK3)
   04066 HIF-1 signaling pathway
    101006756 (MAPK3)
   04068 FoxO signaling pathway
    101006756 (MAPK3)
   04072 Phospholipase D signaling pathway
    101006756 (MAPK3)
   04071 Sphingolipid signaling pathway
    101006756 (MAPK3)
   04024 cAMP signaling pathway
    101006756 (MAPK3)
   04022 cGMP-PKG signaling pathway
    101006756 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101006756 (MAPK3)
   04150 mTOR signaling pathway
    101006756 (MAPK3)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    101006756 (MAPK3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101006756 (MAPK3)
   04148 Efferocytosis
    101006756 (MAPK3)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101006756 (MAPK3)
   04210 Apoptosis
    101006756 (MAPK3)
   04218 Cellular senescence
    101006756 (MAPK3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101006756 (MAPK3)
   04520 Adherens junction
    101006756 (MAPK3)
   04540 Gap junction
    101006756 (MAPK3)
   04550 Signaling pathways regulating pluripotency of stem cells
    101006756 (MAPK3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101006756 (MAPK3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101006756 (MAPK3)
   04613 Neutrophil extracellular trap formation
    101006756 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101006756 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101006756 (MAPK3)
   04625 C-type lectin receptor signaling pathway
    101006756 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101006756 (MAPK3)
   04660 T cell receptor signaling pathway
    101006756 (MAPK3)
   04658 Th1 and Th2 cell differentiation
    101006756 (MAPK3)
   04659 Th17 cell differentiation
    101006756 (MAPK3)
   04657 IL-17 signaling pathway
    101006756 (MAPK3)
   04662 B cell receptor signaling pathway
    101006756 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101006756 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101006756 (MAPK3)
   04062 Chemokine signaling pathway
    101006756 (MAPK3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101006756 (MAPK3)
   04929 GnRH secretion
    101006756 (MAPK3)
   04912 GnRH signaling pathway
    101006756 (MAPK3)
   04915 Estrogen signaling pathway
    101006756 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101006756 (MAPK3)
   04917 Prolactin signaling pathway
    101006756 (MAPK3)
   04921 Oxytocin signaling pathway
    101006756 (MAPK3)
   04926 Relaxin signaling pathway
    101006756 (MAPK3)
   04935 Growth hormone synthesis, secretion and action
    101006756 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101006756 (MAPK3)
   04928 Parathyroid hormone synthesis, secretion and action
    101006756 (MAPK3)
   04916 Melanogenesis
    101006756 (MAPK3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101006756 (MAPK3)
   04270 Vascular smooth muscle contraction
    101006756 (MAPK3)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101006756 (MAPK3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101006756 (MAPK3)
   04725 Cholinergic synapse
    101006756 (MAPK3)
   04726 Serotonergic synapse
    101006756 (MAPK3)
   04720 Long-term potentiation
    101006756 (MAPK3)
   04730 Long-term depression
    101006756 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101006756 (MAPK3)
   04722 Neurotrophin signaling pathway
    101006756 (MAPK3)
  09158 Development and regeneration
   04360 Axon guidance
    101006756 (MAPK3)
   04380 Osteoclast differentiation
    101006756 (MAPK3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101006756 (MAPK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101006756 (MAPK3)
   05206 MicroRNAs in cancer
    101006756 (MAPK3)
   05205 Proteoglycans in cancer
    101006756 (MAPK3)
   05207 Chemical carcinogenesis - receptor activation
    101006756 (MAPK3)
   05208 Chemical carcinogenesis - reactive oxygen species
    101006756 (MAPK3)
   05203 Viral carcinogenesis
    101006756 (MAPK3)
   05230 Central carbon metabolism in cancer
    101006756 (MAPK3)
   05231 Choline metabolism in cancer
    101006756 (MAPK3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101006756 (MAPK3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101006756 (MAPK3)
   05212 Pancreatic cancer
    101006756 (MAPK3)
   05225 Hepatocellular carcinoma
    101006756 (MAPK3)
   05226 Gastric cancer
    101006756 (MAPK3)
   05214 Glioma
    101006756 (MAPK3)
   05216 Thyroid cancer
    101006756 (MAPK3)
   05221 Acute myeloid leukemia
    101006756 (MAPK3)
   05220 Chronic myeloid leukemia
    101006756 (MAPK3)
   05218 Melanoma
    101006756 (MAPK3)
   05211 Renal cell carcinoma
    101006756 (MAPK3)
   05219 Bladder cancer
    101006756 (MAPK3)
   05215 Prostate cancer
    101006756 (MAPK3)
   05213 Endometrial cancer
    101006756 (MAPK3)
   05224 Breast cancer
    101006756 (MAPK3)
   05223 Non-small cell lung cancer
    101006756 (MAPK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101006756 (MAPK3)
   05170 Human immunodeficiency virus 1 infection
    101006756 (MAPK3)
   05161 Hepatitis B
    101006756 (MAPK3)
   05160 Hepatitis C
    101006756 (MAPK3)
   05171 Coronavirus disease - COVID-19
    101006756 (MAPK3)
   05164 Influenza A
    101006756 (MAPK3)
   05163 Human cytomegalovirus infection
    101006756 (MAPK3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101006756 (MAPK3)
   05165 Human papillomavirus infection
    101006756 (MAPK3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101006756 (MAPK3)
   05135 Yersinia infection
    101006756 (MAPK3)
   05133 Pertussis
    101006756 (MAPK3)
   05152 Tuberculosis
    101006756 (MAPK3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101006756 (MAPK3)
   05140 Leishmaniasis
    101006756 (MAPK3)
   05142 Chagas disease
    101006756 (MAPK3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101006756 (MAPK3)
   05020 Prion disease
    101006756 (MAPK3)
   05022 Pathways of neurodegeneration - multiple diseases
    101006756 (MAPK3)
  09165 Substance dependence
   05034 Alcoholism
    101006756 (MAPK3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101006756 (MAPK3)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101006756 (MAPK3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101006756 (MAPK3)
   04934 Cushing syndrome
    101006756 (MAPK3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101006756 (MAPK3)
   01524 Platinum drug resistance
    101006756 (MAPK3)
   01522 Endocrine resistance
    101006756 (MAPK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:panu01001]
    101006756 (MAPK3)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:panu03036]
    101006756 (MAPK3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:panu04147]
    101006756 (MAPK3)
Enzymes [BR:panu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101006756 (MAPK3)
Protein kinases [BR:panu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101006756 (MAPK3)
Chromosome and associated proteins [BR:panu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     101006756 (MAPK3)
Exosome [BR:panu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101006756 (MAPK3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase Kdo FTA2
Other DBs
NCBI-GeneID: 101006756
NCBI-ProteinID: XP_003916792
Ensembl: ENSPANG00000004872
UniProt: A0A096NHR1
LinkDB
Position
18:complement(46694484..46703667)
AA seq 379 aa
MAAAAAQGGGGGEPRRAEGVGPGVPGEVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAY
DHVRKTRVAIKKISPFEHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYI
VQDLMETDLYKLLKSQQLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDL
KICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLS
NRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSD
SKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERL
KELIFQETARFQPGALEAP
NT seq 1140 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggctcaggggggcgggggtggggagccccggagagccgagggggtc
ggcccgggggtcccgggggaggtggagatggtgaaggggcagccgttcgacgtgggcccg
cgctacacgcagctgcagtacatcggcgagggcgcgtacggcatggtcagctcggcctat
gaccacgtgcgcaagactcgcgtggccatcaagaagatcagccccttcgagcatcagacc
tactgccagcgcacgctccgggagatccagatcctgctgcgcttccgccatgagaatgtc
atcggcatccgagacattctgcgtgcgtccaccctggaagccatgagggatgtctacatt
gtgcaggacctgatggagactgacctgtacaagttgctgaaaagccagcaactgagcaat
gaccacatctgctacttcctctaccagatcctgcggggcctcaagtacatccactccgct
aatgtgctccaccgggatctaaagccctccaacctgctcatcaacaccacctgcgacctt
aagatttgcgatttcggcctggctcggattgccgatcctgagcatgaccacaccggcttc
ctgacggaatatgtggctacacgctggtaccgggccccagagatcatgctgaactccaag
ggctataccaagtccatcgacatctggtctgtgggctgcattctggctgagatgctctct
aaccggcccatcttccctggcaagcactacctggatcagctcaaccacattctgggcatc
ctgggctccccatcccaggaggacctgaattgtatcatcaacatgaaggcccgaaactac
ctacagtctctgccctccaagaccaaggtggcttgggccaagcttttccccaagtcagac
tccaaagcccttgacctgctggaccggatgttaacctttaaccccaataaacggatcaca
gtggaggaagcgctggctcacccctacctggagcagtactatgacccgacggatgagcca
gtggccgaggagcccttcaccttcgccatggagctggatgacctacctaaggagcggctg
aaggagctcatcttccaggagacagcacgcttccagcctggggcgctagaggccccctaa

DBGET integrated database retrieval system