Papio anubis (olive baboon): 101006770 Help Entry 101006770         CDS       T07474                                  Name (RefSeq) putative histone H3.X   KO K11253   histone H3 Organism panu  Papio anubis (olive baboon) Pathway panu04613   Neutrophil extracellular trap formation panu05034   Alcoholism panu05202   Transcriptional misregulation in cancer panu05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:panu00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     101006770  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     101006770   09163 Immune disease    05322 Systemic lupus erythematosus     101006770   09165 Substance dependence    05034 Alcoholism     101006770  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:panu03036]     101006770   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:panu04147]     101006770 Chromosome and associated proteins [BR:panu03036]  Eukaryotic type   Nucleosome assembly factors    Histones     101006770 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101006770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S Motif Other DBs NCBI-GeneID:  101006770 NCBI-ProteinID:  XP_031521957 UniProt:  A0A8I5R9K1 LinkDB All DBs Position 5:16837380..16838043 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKATNWQAPRKPLATKAAAKRAPPRGGIKKPHRYKPGTLALREIRKYQKSTQ LLLRKLPFQRLVREIAQAISLDLRFQSAAIGALQEASEAYLVNLFEDTNLCAIHAGRVTI MPGDMQLARRIRGEGA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcgcgcacgaagcagactgcccggaaagccaccaactggcaggcccccaggaagccc ctggccaccaaagcagccgccaaaagggcgccgcctagaggagggatcaagaagcctcac cgctacaagccgggcaccctggcgctgcgggaaatcagaaagtaccagaagtccacgcag ctgctcctgcgcaagctgcctttccagcgcctggtgcgcgagatcgcccaggccatcagc ctggacctgcgcttccagagtgcagccattggcgccctgcaggaggccagcgaggcctac ctggtgaacctctttgaagacaccaacctgtgtgccatccatgccgggcgcgtcacaatt atgcctggagacatgcagctggcccgccgcatccgcggagagggtgcttaa

DBGET integrated database retrieval system