KEGG   Papio anubis (olive baboon): 101007204
Entry
101007204         CDS       T07474                                 
Symbol
NDUFAB1
Name
(RefSeq) acyl carrier protein, mitochondrial
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein
Organism
panu  Papio anubis (olive baboon)
Pathway
panu00190  Oxidative phosphorylation
panu01100  Metabolic pathways
panu04714  Thermogenesis
panu04723  Retrograde endocannabinoid signaling
panu04932  Non-alcoholic fatty liver disease
panu05010  Alzheimer disease
panu05012  Parkinson disease
panu05014  Amyotrophic lateral sclerosis
panu05016  Huntington disease
panu05020  Prion disease
panu05022  Pathways of neurodegeneration - multiple diseases
panu05208  Chemical carcinogenesis - reactive oxygen species
panu05415  Diabetic cardiomyopathy
Module
panu_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
panu_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:panu00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101007204 (NDUFAB1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101007204 (NDUFAB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101007204 (NDUFAB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101007204 (NDUFAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    101007204 (NDUFAB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101007204 (NDUFAB1)
   05012 Parkinson disease
    101007204 (NDUFAB1)
   05014 Amyotrophic lateral sclerosis
    101007204 (NDUFAB1)
   05016 Huntington disease
    101007204 (NDUFAB1)
   05020 Prion disease
    101007204 (NDUFAB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101007204 (NDUFAB1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    101007204 (NDUFAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101007204 (NDUFAB1)
SSDB
Motif
Pfam: PP-binding PP-binding_2 DUF7080
Other DBs
NCBI-GeneID: 101007204
NCBI-ProteinID: XP_003916726
Ensembl: ENSPANG00000019592
UniProt: A0A096NHF4
LinkDB
Position
18:51982892..51994852
AA seq 156 aa
MASRVLSSYVRRLPAAFAPLPRVPMLAVARPLSTGLCSVGTQTRLGPLQPALKLAQVPGR
VTQLCRQYSDMPPLTLEGIRDRVLYVLKLYDKIDPEKLSVDSHFMKDLGLDSLDQVEIIM
AMEDEFGFEIPDTDAEKLMCPQEIVDYIADKKDVYE
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcgtctcgtgtcctttcatcctatgtccgccgcctgcccgcggcctttgcgccgctg
ccccgggtcccgatgctggccgtggcccggcctctcagcaccggtctgtgctccgtgggg
acccagacgaggctcgggcctttgcagccggccttaaagctcgcgcaggttcctggtaga
gttacacagttgtgccgccagtatagcgacatgccccctttgacgttagagggcatccgg
gaccgtgttctttacgtattgaaactctatgacaagattgacccagagaagctttcagta
gattctcattttatgaaagacctgggcttagacagtttggaccaagtggagattatcatg
gccatggaagacgaattcgggtttgaaattcctgatacagatgctgaaaagttaatgtgt
ccacaagaaattgtagattacattgcagataagaaggatgtgtatgaataa

DBGET integrated database retrieval system