Papio anubis (olive baboon): 101012560 Help Entry 101012560         CDS       T07474                                  Name (RefSeq) myosin light polypeptide 6-like   KO K12751   myosin light chain 6 Organism panu  Papio anubis (olive baboon) Pathway panu04270   Vascular smooth muscle contraction panu04530   Tight junction panu04814   Motor proteins panu04921   Oxytocin signaling pathway Brite KEGG Orthology (KO) [BR:panu00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     101012560   09142 Cell motility    04814 Motor proteins     101012560  09150 Organismal Systems   09152 Endocrine system    04921 Oxytocin signaling pathway     101012560   09153 Circulatory system    04270 Vascular smooth muscle contraction     101012560  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:panu04812]     101012560    04147 Exosome [BR:panu04147]     101012560 Cytoskeleton proteins [BR:panu04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      101012560 Exosome [BR:panu04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    101012560   Exosomal proteins of bladder cancer cells    101012560 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_6 EF-hand_7 EF_EFCAB10_C EF-hand_5 AIF-1 Motif Other DBs NCBI-GeneID:  101012560 NCBI-ProteinID:  XP_003910288 UniProt:  A0A8I5NFD0 LinkDB All DBs Position 12:complement(68909965..68911255) Genome browser AA seq 140 aa AA seqDB search MCDFTKDQTTEFKETFQLFDRTGDGKILYSQCGEVMRALGQNPTNTKVLKVLGNPKSDEM NVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLWVSDKEGNGTVMGAEIRHVLVTLGEKM TEEEVEMLVAGHEDSNGCIN NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atgtgtgacttcaccaaagaccagaccacagagttcaaggagaccttccagctgtttgac cgaacaggtgatggcaagatcctgtacagccagtgtggggaggtgatgagggccctgggc cagaaccctaccaacaccaaggtgctcaaggtcctggggaatcccaagagtgatgagatg aatgtgaaggtgctggactttgagcactttctgcccatgctgcagacagtggccaagaac aaggaccagggcacctatgaggattatgttgaaggactttgggtgtctgacaaggaagga aatggcaccgtcatgggtgctgaaatccggcatgttcttgtcacactgggtgagaagatg acagaggaagaagtagagatgctggtggcagggcatgaggacagcaatggttgtatcaac tag

DBGET integrated database retrieval system